Align L-cysteine desulfidase (EC 4.4.1.28) (characterized)
to candidate GFF1378 PGA1_c13950 cysteine synthase CysK
Query= BRENDA::F4K5T2 (323 letters) >FitnessBrowser__Phaeo:GFF1378 Length = 344 Score = 179 bits (453), Expect = 1e-49 Identities = 119/329 (36%), Positives = 177/329 (53%), Gaps = 18/329 (5%) Query: 7 IKNDVTELIGNTPMVYLNKIVDGCVARIAAKLEMMEPCSSIKDRIAYSMIKDAEDKGLIT 66 I +D+ + IG+TP++ LN++ D I K E M P S+KDR A +IKDA +G + Sbjct: 3 IAHDLADAIGHTPLIRLNRVSDETGCEILGKAEFMNPGQSVKDRAALYIIKDAIARGDLK 62 Query: 67 PGKSTLIEATGGNTGIGLASIGASRGYKVILLMPSTMSLERRIILRALGAEV------HL 120 PG T++E T GNTGIGLA +GAS G+K ++++P T S E++ +LR GA++ Sbjct: 63 PG-GTIVEGTAGNTGIGLALVGASMGFKTVIVIPETQSEEKKDMLRLAGAQLVQVPAAPY 121 Query: 121 TDISIGIKGQLEKAKEILSKTPGGYI-PHQFINPENPEIHYRTTGPEIWRDSAGKVDILV 179 + + ++ AKE+ P G I +QF N N + H TT PEIW + GKVD V Sbjct: 122 RNPNNFVRYSERLAKELAKTEPNGAIWANQFDNVANRQAHVETTAPEIWEQTGGKVDGFV 181 Query: 180 AGVGTGGTVTGTGKFLKEKNKDIKVCVVEPSESAVLSG------GKPGPHLIQGIGSGEI 233 VG+GGT+ G L+ K +K+ + +P +A+ S G + +GIG I Sbjct: 182 CAVGSGGTLAGVADALQPKG--VKIGLADPMGAALYSYYTTGEIATEGGSIAEGIGQVRI 239 Query: 234 PANLDLSIVDEIIQVTGEEAIETTKLLAIKEGLLVGISSGASAAAALKVAKRPENVGKLI 293 NL+ D Q+ +A+ L +EGL++G SS + A A+++AK GK I Sbjct: 240 TKNLEGFKPDFCYQIEDRDALPYVFDLLHEEGLVLGGSSAINIAGAVRMAK-DMGPGKTI 298 Query: 294 VVIFPSGGERYLSTELFESVRYEAENLPV 322 V + G RY S +LF +NLPV Sbjct: 299 VTVLCDYGTRYQS-KLFNPDFLREKNLPV 326 Lambda K H 0.314 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 344 Length adjustment: 28 Effective length of query: 295 Effective length of database: 316 Effective search space: 93220 Effective search space used: 93220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory