Align Probable adenylyltransferase/sulfurtransferase MoeZ; EC 2.7.7.-; EC 2.8.1.- (characterized)
to candidate GFF2621 PGA1_c26620 putative molybdopterin biosynthesis protein MoeB
Query= SwissProt::P9WMN7 (392 letters) >FitnessBrowser__Phaeo:GFF2621 Length = 378 Score = 243 bits (619), Expect = 9e-69 Identities = 127/246 (51%), Positives = 167/246 (67%), Gaps = 3/246 (1%) Query: 16 SREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGVGTIGIVDFD 75 S E+ RY+RH+++ +LG GQK+L+ ARVLVIGAGGLGAP L YLAAAGVGTIG++D D Sbjct: 102 SESELDRYARHIVLRELGGPGQKKLRKARVLVIGAGGLGAPALQYLAAAGVGTIGVIDDD 161 Query: 76 VVDESNLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELRLAPSNAVDLFKQYDL 135 +V+ +NLQRQVIH D+G K SA+ ++ A NP + VR + RL A DLF YDL Sbjct: 162 LVENANLQRQVIHRDQDIGIPKVFSAQAAMEAQNPYVTVRPYHRRLDADIATDLFGDYDL 221 Query: 136 ILDGTDNFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAPDGLGVNYRDLYPEPP 195 ILDGTDNF TRYLVN AV GKP + G++ ++EGQ S+F P G Y+ ++PE P Sbjct: 222 ILDGTDNFETRYLVNRTAVALGKPLISGALSQWEGQISLF---HPTAGGPCYQCIFPEAP 278 Query: 196 PPGMVPSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLLVYDALEMSYRTITIR 255 G+ PSC+E GV+G + V ++M EAIK +TG G+TL G +L+YD L R IT+ Sbjct: 279 AAGLAPSCSEAGVVGPLPGVVGAMMALEAIKAVTGAGQTLQGEILIYDGLYSESRKITLS 338 Query: 256 KDPSTP 261 + P Sbjct: 339 QRSDCP 344 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 35 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 378 Length adjustment: 30 Effective length of query: 362 Effective length of database: 348 Effective search space: 125976 Effective search space used: 125976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory