GapMind for Amino acid biosynthesis

 

Aligments for a candidate for serA in Phaeobacter inhibens BS107

Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95 (uncharacterized)
to candidate GFF2436 PGA1_c24680 glyoxylate reductase GyaR

Query= curated2:O29445
         (527 letters)



>lcl|FitnessBrowser__Phaeo:GFF2436 PGA1_c24680 glyoxylate reductase
           GyaR
          Length = 318

 Score =  150 bits (379), Expect = 7e-41
 Identities = 96/321 (29%), Positives = 171/321 (53%), Gaps = 17/321 (5%)

Query: 2   KVLVAEPISEEAIDYMRKNGLEVEVK---TGMSREELIREVPKYEAIVVRSQTKVDAEVI 58
           K+ +  P++  A++   ++    E++   T ++  E  R + +++ ++     + DA   
Sbjct: 4   KLWITRPMTA-AVEARARSEFGAEIRQETTPLTAGERQRALREFDVVMPTLGDQFDAASF 62

Query: 59  Q--AAKNLKIIGRAGVGVDNIDINAATQRGIVVVNAPGGNTISTAEHAIALMLAAARKIP 116
              +A   +++   GVG ++ID++AA   GI V N PG  T +TA+ A+ LML  AR+  
Sbjct: 63  AGVSAPRCRLLANFGVGYNHIDVDAAKTAGIAVSNTPGAVTDATADTALTLMLMTARRAG 122

Query: 117 QADRSVKEGKWER---KKFMGIELRGKTAGVIGLGRVGFEVAKRCK---ALEMNVLAYDP 170
           + +R V+ G+W+     + +G+ L GK  G++G GR+G  +A+RC     + ++ LA   
Sbjct: 123 EGERLVRSGQWQGWHPTQMLGLHLTGKHVGIVGFGRIGEAIARRCHFGFGMSVSYLAR-- 180

Query: 171 FVSKERAEQIGVKLVDFDTLLASSDVITVHVPRTKETIGLIGKGQFEKMKDGVIVVNAAR 230
             S++      V+      L AS DV+ + VP   ET  LI       M+   +++N AR
Sbjct: 181 --SEKSPGFPAVRADSLTALAASVDVLVLAVPGGAETRHLINAEVLAAMRPEALLINIAR 238

Query: 231 GGIVDEAALYEAIKAGKVAAAALDVYEKEPPSPDNPLLKLDNVVTTPHIAASTREAQLNV 290
           G +VDEAAL  A++ G++A A LDVYE EP  P   L +++ V   PH+  +T E + ++
Sbjct: 239 GEVVDEAALISALQTGQIAGAGLDVYEFEPEVP-LALQQMEQVTLLPHLGTATEEVRSDM 297

Query: 291 GMIIAEDIVNMAKGLPVRNAV 311
           G +  +++     G P+ + V
Sbjct: 298 GHLALDNVAAFLAGKPLISPV 318


Lambda     K      H
   0.317    0.136    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 324
Number of extensions: 13
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 527
Length of database: 318
Length adjustment: 31
Effective length of query: 496
Effective length of database: 287
Effective search space:   142352
Effective search space used:   142352
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory