Align 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (characterized)
to candidate GFF2936 PGA1_c29830 3-isopropylmalate dehydrogenase LeuB
Query= BRENDA::P24404 (370 letters) >FitnessBrowser__Phaeo:GFF2936 Length = 367 Score = 423 bits (1088), Expect = e-123 Identities = 222/364 (60%), Positives = 273/364 (75%), Gaps = 4/364 (1%) Query: 1 MTVRSLFLLPGDGIGPEAMTEVRKLIEYMNSAHNAGFTVSEGLVGGSAYDAHGVAISDAD 60 M+ S+ +LPGDGIGPE M EVRK+I + + F VSE LVGG+AYD HG ++D Sbjct: 1 MSNPSILILPGDGIGPEVMAEVRKVISWYGEKRDLQFDVSEDLVGGAAYDVHGKPLADET 60 Query: 61 MEKALAADAILFGAVGGPKWDGVPYEHRPEAGLLRLRKDLELFANLRPAICYPALAAASS 120 MEKA DA+L GAVGGPK+D + + +PE GLLRLRK+++L++NLRPA C+ ALA SS Sbjct: 61 MEKAQEVDAVLLGAVGGPKYDDLDFSVKPERGLLRLRKEMDLYSNLRPAQCFDALADFSS 120 Query: 121 LKPELVEGLDILIVRELTGGVYFGEPKQIIDLGNGQKRGIDTQIYDTFEIERIASVAFEL 180 LK ++V GLDI+IVRELT GVYFGEP+ I + GN ++ GI+TQ Y EIER A AFEL Sbjct: 121 LKKDIVAGLDIMIVRELTSGVYFGEPRGIFEEGN-ERVGINTQRYTESEIERAARSAFEL 179 Query: 181 ARSRDNRVCSMEKRNVMKSGVLWNQVVTETHAAKYKDVQLEHMLADAGGMQLVRKPKQFD 240 A R+ ++CSMEK NVM+SG+LW +VVT AA Y +V+L HM AD G MQLVR PKQFD Sbjct: 180 AMRRNKKLCSMEKANVMESGILWREVVTRV-AADYPEVELSHMYADNGAMQLVRAPKQFD 238 Query: 241 VIVTDNLFGDMLSDVAAMLTGSLGMLPSASLGAPDAKTGKRKAMYEPVHGSAPDIAGKSI 300 VI+TDNLFGD+LSD AAMLTGSLGMLPSASLGAP A G+ KA+YEPVHGSAPDIAG+ Sbjct: 239 VILTDNLFGDILSDCAAMLTGSLGMLPSASLGAPMA-NGRPKALYEPVHGSAPDIAGQGK 297 Query: 301 ANPIAMIASFAMCLRYSFNMVDEATKLEAAIANVLDKGIRTADIMA-DGCRQVGTSDMGD 359 ANPIA I SFAM LRYSF+ EA +LE A+ VL G RT D++ +G + TS+MGD Sbjct: 298 ANPIACILSFAMALRYSFDQGSEADRLETAVEKVLADGHRTGDLLGEEGVSPISTSEMGD 357 Query: 360 AVLA 363 ++A Sbjct: 358 VIIA 361 Lambda K H 0.319 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 367 Length adjustment: 30 Effective length of query: 340 Effective length of database: 337 Effective search space: 114580 Effective search space used: 114580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate GFF2936 PGA1_c29830 (3-isopropylmalate dehydrogenase LeuB)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.12978.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-150 485.8 0.0 4.1e-150 485.6 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF2936 PGA1_c29830 3-isopropylmalate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF2936 PGA1_c29830 3-isopropylmalate dehydrogenase LeuB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 485.6 0.0 4.1e-150 4.1e-150 2 348 .. 6 358 .. 5 359 .. 0.97 Alignments for each domain: == domain 1 score: 485.6 bits; conditional E-value: 4.1e-150 TIGR00169 2 iavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlgavGGpkWd 77 i +LpGDgiGpev+ae kv+ e+ +l+++ +e l+GGaa d +g+Pl++et+++++e+davLlgavGGpk+d lcl|FitnessBrowser__Phaeo:GFF2936 6 ILILPGDGIGPEVMAEVRKVISWYGEKRDLQFDVSEDLVGGAAYDVHGKPLADETMEKAQEVDAVLLGAVGGPKYD 81 889************************************************************************* PP TIGR00169 78 nlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvreLtgGiYfGepkereeaeeekk 153 +l +v+Pe+gLL+lrke+dl++nLrPa+ f++L ++s+lk++iv g+D+++vreLt+G+YfGep++++e+++e+ lcl|FitnessBrowser__Phaeo:GFF2936 82 DLDFSVKPERGLLRLRKEMDLYSNLRPAQCFDALADFSSLKKDIVAGLDIMIVRELTSGVYFGEPRGIFEEGNERV 157 **************************************************************************** PP TIGR00169 154 aldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeiakeyPdvelehlyiDnaamqLvks 229 +++t++Yt++eier ar afela++r+kk++s++kanv+es++lWr++v+ +a +yP+vel+h+y Dn amqLv++ lcl|FitnessBrowser__Phaeo:GFF2936 158 GINTQRYTESEIERAARSAFELAMRRNKKLCSMEKANVMESGILWREVVTRVAADYPEVELSHMYADNGAMQLVRA 233 **************************************************************************** PP TIGR00169 230 PeqldvvvtsnlfGDilsDeasvitGslGlLPsaslss.....kglalfepvhgsapdiagkgianpiaailsaal 300 P+q+dv++t+nlfGDilsD a+++tGslG+LPsasl+ + +al+epvhgsapdiag+g anpia ils a+ lcl|FitnessBrowser__Phaeo:GFF2936 234 PKQFDVILTDNLFGDILSDCAAMLTGSLGMLPSASLGApmangRPKALYEPVHGSAPDIAGQGKANPIACILSFAM 309 *************************************9998888899***************************** PP TIGR00169 301 llryslnleeaaeaieaavkkvleegkrtedlaseat.tavstkeveee 348 lrys+++ +a+++e+av+kvl++g+rt dl +e++ st+e++++ lcl|FitnessBrowser__Phaeo:GFF2936 310 ALRYSFDQGSEADRLETAVEKVLADGHRTGDLLGEEGvSPISTSEMGDV 358 ******************************9877664166788888776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (367 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.37 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory