Align 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (characterized)
to candidate GFF2936 PGA1_c29830 3-isopropylmalate dehydrogenase LeuB
Query= BRENDA::P24404 (370 letters) >FitnessBrowser__Phaeo:GFF2936 Length = 367 Score = 423 bits (1088), Expect = e-123 Identities = 222/364 (60%), Positives = 273/364 (75%), Gaps = 4/364 (1%) Query: 1 MTVRSLFLLPGDGIGPEAMTEVRKLIEYMNSAHNAGFTVSEGLVGGSAYDAHGVAISDAD 60 M+ S+ +LPGDGIGPE M EVRK+I + + F VSE LVGG+AYD HG ++D Sbjct: 1 MSNPSILILPGDGIGPEVMAEVRKVISWYGEKRDLQFDVSEDLVGGAAYDVHGKPLADET 60 Query: 61 MEKALAADAILFGAVGGPKWDGVPYEHRPEAGLLRLRKDLELFANLRPAICYPALAAASS 120 MEKA DA+L GAVGGPK+D + + +PE GLLRLRK+++L++NLRPA C+ ALA SS Sbjct: 61 MEKAQEVDAVLLGAVGGPKYDDLDFSVKPERGLLRLRKEMDLYSNLRPAQCFDALADFSS 120 Query: 121 LKPELVEGLDILIVRELTGGVYFGEPKQIIDLGNGQKRGIDTQIYDTFEIERIASVAFEL 180 LK ++V GLDI+IVRELT GVYFGEP+ I + GN ++ GI+TQ Y EIER A AFEL Sbjct: 121 LKKDIVAGLDIMIVRELTSGVYFGEPRGIFEEGN-ERVGINTQRYTESEIERAARSAFEL 179 Query: 181 ARSRDNRVCSMEKRNVMKSGVLWNQVVTETHAAKYKDVQLEHMLADAGGMQLVRKPKQFD 240 A R+ ++CSMEK NVM+SG+LW +VVT AA Y +V+L HM AD G MQLVR PKQFD Sbjct: 180 AMRRNKKLCSMEKANVMESGILWREVVTRV-AADYPEVELSHMYADNGAMQLVRAPKQFD 238 Query: 241 VIVTDNLFGDMLSDVAAMLTGSLGMLPSASLGAPDAKTGKRKAMYEPVHGSAPDIAGKSI 300 VI+TDNLFGD+LSD AAMLTGSLGMLPSASLGAP A G+ KA+YEPVHGSAPDIAG+ Sbjct: 239 VILTDNLFGDILSDCAAMLTGSLGMLPSASLGAPMA-NGRPKALYEPVHGSAPDIAGQGK 297 Query: 301 ANPIAMIASFAMCLRYSFNMVDEATKLEAAIANVLDKGIRTADIMA-DGCRQVGTSDMGD 359 ANPIA I SFAM LRYSF+ EA +LE A+ VL G RT D++ +G + TS+MGD Sbjct: 298 ANPIACILSFAMALRYSFDQGSEADRLETAVEKVLADGHRTGDLLGEEGVSPISTSEMGD 357 Query: 360 AVLA 363 ++A Sbjct: 358 VIIA 361 Lambda K H 0.319 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 367 Length adjustment: 30 Effective length of query: 340 Effective length of database: 337 Effective search space: 114580 Effective search space used: 114580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate GFF2936 PGA1_c29830 (3-isopropylmalate dehydrogenase LeuB)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.1538.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-150 485.8 0.0 4.1e-150 485.6 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF2936 PGA1_c29830 3-isopropylmalate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF2936 PGA1_c29830 3-isopropylmalate dehydrogenase LeuB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 485.6 0.0 4.1e-150 4.1e-150 2 348 .. 6 358 .. 5 359 .. 0.97 Alignments for each domain: == domain 1 score: 485.6 bits; conditional E-value: 4.1e-150 TIGR00169 2 iavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlgavGGpkWd 77 i +LpGDgiGpev+ae kv+ e+ +l+++ +e l+GGaa d +g+Pl++et+++++e+davLlgavGGpk+d lcl|FitnessBrowser__Phaeo:GFF2936 6 ILILPGDGIGPEVMAEVRKVISWYGEKRDLQFDVSEDLVGGAAYDVHGKPLADETMEKAQEVDAVLLGAVGGPKYD 81 889************************************************************************* PP TIGR00169 78 nlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvreLtgGiYfGepkereeaeeekk 153 +l +v+Pe+gLL+lrke+dl++nLrPa+ f++L ++s+lk++iv g+D+++vreLt+G+YfGep++++e+++e+ lcl|FitnessBrowser__Phaeo:GFF2936 82 DLDFSVKPERGLLRLRKEMDLYSNLRPAQCFDALADFSSLKKDIVAGLDIMIVRELTSGVYFGEPRGIFEEGNERV 157 **************************************************************************** PP TIGR00169 154 aldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeiakeyPdvelehlyiDnaamqLvks 229 +++t++Yt++eier ar afela++r+kk++s++kanv+es++lWr++v+ +a +yP+vel+h+y Dn amqLv++ lcl|FitnessBrowser__Phaeo:GFF2936 158 GINTQRYTESEIERAARSAFELAMRRNKKLCSMEKANVMESGILWREVVTRVAADYPEVELSHMYADNGAMQLVRA 233 **************************************************************************** PP TIGR00169 230 PeqldvvvtsnlfGDilsDeasvitGslGlLPsaslss.....kglalfepvhgsapdiagkgianpiaailsaal 300 P+q+dv++t+nlfGDilsD a+++tGslG+LPsasl+ + +al+epvhgsapdiag+g anpia ils a+ lcl|FitnessBrowser__Phaeo:GFF2936 234 PKQFDVILTDNLFGDILSDCAAMLTGSLGMLPSASLGApmangRPKALYEPVHGSAPDIAGQGKANPIACILSFAM 309 *************************************9998888899***************************** PP TIGR00169 301 llryslnleeaaeaieaavkkvleegkrtedlaseat.tavstkeveee 348 lrys+++ +a+++e+av+kvl++g+rt dl +e++ st+e++++ lcl|FitnessBrowser__Phaeo:GFF2936 310 ALRYSFDQGSEADRLETAVEKVLADGHRTGDLLGEEGvSPISTSEMGDV 358 ******************************9877664166788888776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (367 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.47 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory