GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvI in Phaeobacter inhibens BS107

Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate GFF1988 PGA1_c20220 acetolactate synthase isozyme 3 small subunit

Query= BRENDA::P00894
         (163 letters)



>lcl|FitnessBrowser__Phaeo:GFF1988 PGA1_c20220 acetolactate synthase
           isozyme 3 small subunit
          Length = 186

 Score =  127 bits (320), Expect = 8e-35
 Identities = 73/160 (45%), Positives = 104/160 (65%), Gaps = 3/160 (1%)

Query: 2   RRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDP-TLSRMTIQTVGDEKVLEQI 60
           R  +++L+ENE G L+RVIGLFS RGYNI+SLTVA  D    LSR+TI T G  +V+EQI
Sbjct: 28  RHTITILVENEPGVLARVIGLFSGRGYNIDSLTVAEVDHTGHLSRITIVTTGTPQVIEQI 87

Query: 61  EKQLHKLVDVLRVSELG-QGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSL 119
           + QL ++V V  V++L   G  VERE+ +VK+   G  R E  R  EIFR +++D T + 
Sbjct: 88  KAQLGRIVSVHEVTDLTVAGPFVERELAIVKVVGEGEKRVEAMRLAEIFRAKVVDTTLNS 147

Query: 120 YTVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGD 159
           +  +L G   K+DAF   +R +  + ++AR+GV  L RG+
Sbjct: 148 FIFELTGAPDKIDAFAEMMRPLG-LTKIARTGVAALLRGN 186


Lambda     K      H
   0.318    0.136    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 89
Number of extensions: 4
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 163
Length of database: 186
Length adjustment: 19
Effective length of query: 144
Effective length of database: 167
Effective search space:    24048
Effective search space used:    24048
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 44 (21.6 bits)

Align candidate GFF1988 PGA1_c20220 (acetolactate synthase isozyme 3 small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00119.hmm
# target sequence database:        /tmp/gapView.9551.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00119  [M=158]
Accession:   TIGR00119
Description: acolac_sm: acetolactate synthase, small subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
    2.1e-56  176.4   0.8    2.4e-56  176.2   0.8    1.0  1  lcl|FitnessBrowser__Phaeo:GFF1988  PGA1_c20220 acetolactate synthas


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Phaeo:GFF1988  PGA1_c20220 acetolactate synthase isozyme 3 small subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  176.2   0.8   2.4e-56   2.4e-56       2     158 .]      28     186 .]      27     186 .] 0.96

  Alignments for each domain:
  == domain 1  score: 176.2 bits;  conditional E-value: 2.4e-56
                          TIGR00119   2 khvlsvlvenepGvLsrvsGlfarrgfniesltvgeteek.dlsrmtivvegddkvveqiekqleklvdvlkvldl 76 
                                        +h++++lvenepGvL+rv+Glf+ rg+ni+sltv+e +++ +lsr+tiv++g  +v+eqi+ ql ++v v +v+dl
  lcl|FitnessBrowser__Phaeo:GFF1988  28 RHTITILVENEPGVLARVIGLFSGRGYNIDSLTVAEVDHTgHLSRITIVTTGTPQVIEQIKAQLGRIVSVHEVTDL 103
                                        8***********************************996527********************************** PP

                          TIGR00119  77 tes.eivkrelvlvkvsalgeerneikelteifrgrvvDvsedslivelsgkedkisaflkllkefgikevarsGl 151
                                        t +   v+rel++vkv   ge+r e ++l+eifr++vvD + +s+i el+g +dki+af ++++++g+  +ar+G+
  lcl|FitnessBrowser__Phaeo:GFF1988 104 TVAgPFVERELAIVKVVGEGEKRVEAMRLAEIFRAKVVDTTLNSFIFELTGAPDKIDAFAEMMRPLGLTKIARTGV 179
                                        965289********************************************************************** PP

                          TIGR00119 152 valsrge 158
                                         al rg+
  lcl|FitnessBrowser__Phaeo:GFF1988 180 AALLRGN 186
                                        ****985 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (158 nodes)
Target sequences:                          1  (186 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 4.97
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory