GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuA in Phaeobacter inhibens BS107

Align Probable 2-isopropylmalate synthase; EC 2.3.3.13; Alpha-IPM synthase; Alpha-isopropylmalate synthase (uncharacterized)
to candidate GFF1624 PGA1_c16460 2-isopropylmalate synthase/homocitrate synthase-like protein

Query= curated2:Q8TYB1
         (499 letters)



>lcl|FitnessBrowser__Phaeo:GFF1624 PGA1_c16460 2-isopropylmalate
           synthase/homocitrate synthase-like protein
          Length = 543

 Score =  217 bits (552), Expect = 9e-61
 Identities = 166/526 (31%), Positives = 268/526 (50%), Gaps = 39/526 (7%)

Query: 3   DRVRIFDTTLRDGEQTPGVSLTVEEKVEIARKLDEFGVDTIEAGFPVAS---EGEFEAV- 58
           +R+ ++DTTLRDG+QT GV  +  EKV+IA  LD  GVD IE G+P A+    G F+A  
Sbjct: 4   ERLYLYDTTLRDGQQTQGVQFSTTEKVQIATALDGLGVDYIEGGWPGANPTDSGFFDAAP 63

Query: 59  RAIAGEELDAEICGLARCVKGD--IDAAIDADVDCVHVFIATSDIHLRYKLEMSREEALE 116
           R  A            R  + D  + A ++A    V +   + D H+ + L ++ EE L+
Sbjct: 64  RTRATMTAFGMTKRAGRSAENDDVLAAVLNAGTAAVCLVGKSHDYHVTHALGITLEENLD 123

Query: 117 RAIEGVEYASDHGVTVEFSAE---DATRTDRDYLLEVYKATVEAGADRVNVPDTVGVMTP 173
                + +    G    F AE   D  + + DY L   +A +EAGA  V + DT G   P
Sbjct: 124 NIRASIAHLVAQGREALFDAEHFFDGYKDNPDYALAACRAALEAGARWVVLCDTNGGTLP 183

Query: 174 PEMYRLTAEVVDAVDVP---VSVHCHNDFGMAVANSLAAVEAGAEQVHVTVNGIGERAGN 230
            ++ R+ AEV+ A  +P   + +H HND   AVA SLAAV+AGA Q+  T+NG+GER GN
Sbjct: 184 GDVGRIVAEVI-AAGLPGDHLGIHTHNDTENAVACSLAAVDAGARQIQGTLNGLGERCGN 242

Query: 231 ASLEQVV--MALKALYDIELDVRTE-----MLVELSRLVERLTGVVVPPNTPIVGENAFA 283
           A+L  ++  + LK  Y  + D+         L  LSR+++ +   V       VG +AFA
Sbjct: 243 ANLTTLIPTLLLKPPYADQFDIGVSHEGLSTLTALSRMLDEILNRVPTKQAAYVGASAFA 302

Query: 284 HESGIHSHGVIKKAETYEPIRPEDVGHRRRIVLGKHAGRHAIKKKLEEMGIEVT--EEQL 341
           H++G+H+  ++K   TYE I P  VG+ R I +   AG+  ++++L E G+ V   +  L
Sbjct: 303 HKAGLHASAILKDPSTYEHIDPALVGNARIIPMSNQAGQSNLRRRLSEAGLRVENGDPAL 362

Query: 342 DEIVRRVKELGDKGKR--VTEDDLEAIARDVVGEVPESEAAVKLEEIAVMTGNKFTPTAS 399
             I+ R+K    +G      +   E +AR+ +G++P      + +       NK+    S
Sbjct: 363 ARILERIKTREAEGYSYDTAQASFEILAREELGQLPSFFEVKRYKVTVERRKNKYDRMVS 422

Query: 400 -----VRVYLDGEEHEAASTGV---GSVDAAIRALREAI-EELGM------DVELKEYRL 444
                V V +DG++  + S  +   GS    + AL +A+ ++LG       D+ L ++++
Sbjct: 423 LSEAVVVVKVDGQKLLSVSESLDETGSDRGPVNALAKALTKDLGQYSKALDDMRLVDFKV 482

Query: 445 EAITGGTDALAEVTVRLEDEDGNVTTARGAAEDIVMASVKAFVRGV 490
               GGT+A+  V +  ED  G   +  G + +I+ AS +A +  +
Sbjct: 483 RITQGGTEAVTRVIIDSEDGAGRRWSTVGVSANIIDASFEALLDAI 528


Lambda     K      H
   0.315    0.133    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 565
Number of extensions: 24
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 499
Length of database: 543
Length adjustment: 35
Effective length of query: 464
Effective length of database: 508
Effective search space:   235712
Effective search space used:   235712
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory