Align Aspartate kinase Ask_LysC; Aspartokinase; EC 2.7.2.4 (characterized)
to candidate GFF2319 PGA1_c23510 aspartokinase LysC
Query= SwissProt::A4VJB4 (412 letters) >lcl|FitnessBrowser__Phaeo:GFF2319 PGA1_c23510 aspartokinase LysC Length = 412 Score = 399 bits (1026), Expect = e-116 Identities = 217/413 (52%), Positives = 292/413 (70%), Gaps = 7/413 (1%) Query: 1 MALIVQKFGGTSVGTVERIEQVAEKVKKFRDGGDDIVVVVSAMSGETNRLIDLAKQISEQ 60 M ++V KFGGTSV ++RI + A++V G +++V+VSAMSG+TN L+ + S Sbjct: 1 MPVLVMKFGGTSVANLDRIRRAAKRVGVEVAKGYNVIVIVSAMSGKTNELVGWVNETSPL 60 Query: 61 PVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHTKARILQIDAQR 120 RE D +VS+GE VT L+A+ L + +PA S+ G QV + T SAH++ARI +I + Sbjct: 61 FDAREYDAVVSSGENVTAGLMALTLQEMDIPARSWQGWQVPLKTTSAHSQARIEEIPPEN 120 Query: 121 IQRDIKAG-RVVVVAGFQGVDEKGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVY 179 I G RV VVAGFQG+ +G ITTLGRGGSDTT VA AAA +A+ C IYTDVDGVY Sbjct: 121 INAKFGEGMRVAVVAGFQGISPEGRITTLGRGGSDTTAVAFAAAFEAERCDIYTDVDGVY 180 Query: 180 TTDPRVVAKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYSVPLRVLHSFQE---GP 236 TTDPR+ KA++LDKI FEEMLE+ASLG+KVLQ R+VE A +Y V LRVL SF+E Sbjct: 181 TTDPRICDKARKLDKIAFEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEEQSDEA 240 Query: 237 GTLITLDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQ 296 GTL+ DEEE ME +++G+A++RDEAKLT++ V D PG+A I +S A V VDMIVQ Sbjct: 241 GTLV-CDEEEIMESNVVAGVAYSRDEAKLTVQSVADRPGIAAHIFTALSEAGVNVDMIVQ 299 Query: 297 NVAHDNTTDFTFTVHRNDYNNALQVLQGI--AAEMGAREAIGDTNIAKVSIVGVGMRSHA 354 +++ + TD TF+ + A Q LQ + E+ E + D ++AKVS+VG+GMRS + Sbjct: 300 DISDEGRTDMTFSCPTDQVVRAEQALQAVKEKGELNYAELLADRDVAKVSVVGIGMRSQS 359 Query: 355 GVASRMFEALAKENINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPA 407 GVA++MF+ L+ E INI++I+TSEIK+SV+I+ KY+ELAV+ALH AFELD A Sbjct: 360 GVAAKMFKVLSDEGINIKVITTSEIKISVLIDRKYMELAVQALHDAFELDKAA 412 Lambda K H 0.317 0.133 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 412 Length of database: 412 Length adjustment: 31 Effective length of query: 381 Effective length of database: 381 Effective search space: 145161 Effective search space used: 145161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate GFF2319 PGA1_c23510 (aspartokinase LysC)
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00656.hmm # target sequence database: /tmp/gapView.6923.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00656 [M=407] Accession: TIGR00656 Description: asp_kin_monofn: aspartate kinase, monofunctional class Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-129 418.5 7.5 1.7e-129 418.3 7.5 1.0 1 lcl|FitnessBrowser__Phaeo:GFF2319 PGA1_c23510 aspartokinase LysC Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF2319 PGA1_c23510 aspartokinase LysC # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 418.3 7.5 1.7e-129 1.7e-129 3 406 .. 3 408 .. 1 409 [. 0.95 Alignments for each domain: == domain 1 score: 418.3 bits; conditional E-value: 1.7e-129 TIGR00656 3 liVqKFGGtsvgsserikkaakivlkelkegkkvvVVvSAmskvtdelvelaellklleaisdeisprerdelvsv 78 + V+KFGGtsv++ +ri++aak+v e+ +g++v+V+vSAms++t+elv + + +s re d +vs lcl|FitnessBrowser__Phaeo:GFF2319 3 VLVMKFGGTSVANLDRIRRAAKRVGVEVAKGYNVIVIVSAMSGKTNELVGWV------NETSPLFDAREYDAVVSS 72 78**************************************************......8999999*********** PP TIGR00656 79 GEllssallssalrelgvkaealdgkeagilTddefgnAkikelateerLlelLeegi.ivvvaGFiGateeGeiT 153 GE +++ l++ l+e + a++ +g++ ++ T + + +A+i+e+ + e++ eg+ + vvaGF+G eG+iT lcl|FitnessBrowser__Phaeo:GFF2319 73 GENVTAGLMALTLQEMDIPARSWQGWQVPLKTTSAHSQARIEEIPP-ENINAKFGEGMrVAVVAGFQGISPEGRIT 147 **********************************************.88888888875489*************** PP TIGR00656 154 tLGRGGSDltAallaaalkAdrveiyTDVeGvyttDPrvveeakkidkisyeEalelAtlGakvlhpralelavea 229 tLGRGGSD+tA++ aaa +A+r++iyTDV+GvyttDPr+ ++a+k+dki++eE+lelA+lGakvl+ r++ela+++ lcl|FitnessBrowser__Phaeo:GFF2319 148 TLGRGGSDTTAVAFAAAFEAERCDIYTDVDGVYTTDPRICDKARKLDKIAFEEMLELASLGAKVLQTRSVELAMRY 223 **************************************************************************** PP TIGR00656 230 kvpilvrsskeke...egTlitnkkens..slvkaialeknvarltvegegmlgkrgilaeifkaLaeeeinvdli 300 kv+++v ss+e++ +gTl+++++e ++v ++a++++ a+ltv+ ++++++gi+a+if+aL+e+++nvd+i lcl|FitnessBrowser__Phaeo:GFF2319 224 KVKLRVLSSFEEQsdeAGTLVCDEEEIMesNVVAGVAYSRDEAKLTVQ--SVADRPGIAAHIFTALSEAGVNVDMI 297 ********998654468*****954433236*****************..************************** PP TIGR00656 301 sqtese...tsislvvdeedvdeakkaLkeesgaae..lesleveedlavvsivgaglveapGvaseifkaleekn 371 +q s+ t+++++ + +v +a++aL++++++ e + +l ++d+a+vs+vg g+++++Gva+++fk+l++++ lcl|FitnessBrowser__Phaeo:GFF2319 298 VQDISDegrTDMTFSCPTDQVVRAEQALQAVKEKGElnYAELLADRDVAKVSVVGIGMRSQSGVAAKMFKVLSDEG 373 **9987788********************99877666699999********************************* PP TIGR00656 372 inilmisssetkisvlvdekdaekavrklheklee 406 ini+ i++se+kisvl+d k++e av++lh+++e+ lcl|FitnessBrowser__Phaeo:GFF2319 374 INIKVITTSEIKISVLIDRKYMELAVQALHDAFEL 408 *********************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (407 nodes) Target sequences: 1 (412 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 8.49 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory