Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate GFF201 PGA1_c02050 acetylglutamate kinase ArgB
Query= curated2:A8AA51 (264 letters) >FitnessBrowser__Phaeo:GFF201 Length = 286 Score = 109 bits (273), Expect = 6e-29 Identities = 81/259 (31%), Positives = 127/259 (49%), Gaps = 31/259 (11%) Query: 1 MIVVKAGGRTLLNN--MDEIVKSISRLEKA----VFVHGGGDLVDEWERKMGMEPQFKVS 54 ++VVK GG + ++ M+ + I L + V VHGGG +++ K+ ++ F Sbjct: 31 IVVVKLGGHAMGSDEAMETFARDIVLLRQVGVNPVIVHGGGPMINAMLEKLQIKSDFVNG 90 Query: 55 ASGIKFRYTDEKELEVFVAVLGGLLNKKIVASFASYGRGAVGLTGADGPSVIAERKKKVI 114 R TD +EV VL G++NK+IV + G VGL+G D + + + Sbjct: 91 K-----RVTDAATMEVVEMVLSGVVNKRIVQAINRQGGAGVGLSGKDANLITCTQADPDL 145 Query: 115 VQEKVGERLVKRAIAGGYTGKIKEVKTDLIKALVERGLVPVVAPIALSPEGELLNVNGDQ 174 G+ G ++ ++ L E+ ++PV+API P+GE N+NGD Sbjct: 146 ----------------GFVGTPSQMDPSVLHHLFEQDMIPVIAPIGAGPDGETFNINGDT 189 Query: 175 MAAELAKALSAEYLVLLTDVPGVLMD-GKVVPEIKSSEAEEVAKK--VGPGMNIKIIMA- 230 A +A AL A+ L+LLTDV GV G+VV E+K+++ E + + + GM K A Sbjct: 190 AAGAIASALKADRLLLLTDVSGVKNGAGEVVTELKAADVEAMTRDGVIIGGMIPKTETAL 249 Query: 231 GRVASGGTKVVICDGTVPD 249 V SG I DG VP+ Sbjct: 250 AAVRSGVRACTIVDGRVPN 268 Lambda K H 0.316 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 286 Length adjustment: 25 Effective length of query: 239 Effective length of database: 261 Effective search space: 62379 Effective search space used: 62379 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory