Align cysteine-S-conjugate beta-lyase (EC 4.4.1.13); alanine racemase (EC 5.1.1.1); glutamate racemase (EC 5.1.1.3) (characterized)
to candidate GFF1649 PGA1_c16720 putative pyridoxal phosphate-dependent transferase
Query= BRENDA::Q9X0Z7 (379 letters) >FitnessBrowser__Phaeo:GFF1649 Length = 383 Score = 219 bits (557), Expect = 1e-61 Identities = 130/367 (35%), Positives = 202/367 (55%), Gaps = 18/367 (4%) Query: 19 ALSFPIFETTNFYFDSFDEMSKALRNGDYEFVYKRGSNPTTRLVEKKLAALEECEDARLV 78 A++ PI +T+ F FDS++ + +Y R NPT E +A E+ E A Sbjct: 21 AITPPIVQTSLFSFDSYEAFEDRMAGRSNAAIYTRVQNPTVAAFESLMAKAEQGEAAVAF 80 Query: 79 ASGMSAISLSILHFLSSGDHVVCVDEAYSWAKKFFNYLSKKFDIEVSYVPPDAERIVEAI 138 ASGM+AIS ++L F+ GD + CV+ Y + +F + + F +E+ Y P + Sbjct: 81 ASGMAAISSTLLAFVKPGDRIACVEHVYPDSYRFMERMLRPFGVEIDYYAPHQLEEEPEL 140 Query: 139 TKKTKLIYLESPTSMRMKVIDIRKVTEAAGELKIKTVIDNTWASPIFQKPKLLGVDVVVH 198 +L YLESP+S+ + ++++KVT A + T+IDN+WASP+FQKP GVD+V+H Sbjct: 141 LNGVRLAYLESPSSVVFQPLNLKKVTAHAKRHGVLTMIDNSWASPVFQKPLTQGVDIVLH 200 Query: 199 SATKYISGHGDVMAGVIAGDVEDMKNIFVDEYKNIGPVLSPIEAWLILRGLRTLELRMKK 258 SA+KYISGH D +AGV+ + + I +G L+P EA+L+ RGLRTL RM++ Sbjct: 201 SASKYISGHSDTVAGVVVAAQQHIDRIRDLTLPLLGAKLAPFEAFLLTRGLRTLSARMRQ 260 Query: 259 HYENALVVSDFLMDHPKVLEVNYPMNPRSPQYELASSQMSGGSGLMSFRLKTDSAEKVKE 318 H A + D L P+V V+ P P ++G SGLM+ ++ D + + Sbjct: 261 HQATATLFIDRLSALPQVRRVHSPGPNEVP-------GLTGRSGLMA--VEFDDSVDIPA 311 Query: 319 FVESLRVFRMAVSWGSHENLVVP-RVAYGDCPKKD--------VNLIRIHVGLGDPEKLV 369 F +L FR+ VSWG E+L++P RV +++ NL+R+++GL + E L Sbjct: 312 FSNALSHFRLGVSWGGFESLILPARVGLAQIGEENSMQRFGVSPNLVRLNLGLEEAEDLW 371 Query: 370 EDLDQAL 376 D+ AL Sbjct: 372 ADITSAL 378 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 383 Length adjustment: 30 Effective length of query: 349 Effective length of database: 353 Effective search space: 123197 Effective search space used: 123197 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory