Align Ornithine aminotransferase; OTAse; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 (characterized)
to candidate GFF3422 PGA1_c34750 putative aminotransferase class 3
Query= SwissProt::P07991 (424 letters) >FitnessBrowser__Phaeo:GFF3422 Length = 1009 Score = 149 bits (376), Expect = 4e-40 Identities = 127/418 (30%), Positives = 200/418 (47%), Gaps = 43/418 (10%) Query: 27 PVVFHKAKGAHVWDPEGKLYLDFLSAYSAV-NQGHCHPHIIKALTEQAQTLTLSSRAFHN 85 PV+ + H++D G+ YLD AY+ V + GH HP I +Q + + ++R H Sbjct: 604 PVMLLRGWKHHLFDEWGRPYLD---AYNNVPHVGHAHPRIQAIAADQLKRMNSNTRYLHP 660 Query: 86 DVYAQFAKFVTEFFG-FETVLPMNTGAEAVETALKLARRWGYMKKNIPQDKAIILGAEGN 144 A K +++ E +N+G EA E AL+LAR K + D Sbjct: 661 AQNAFAEKILSKMPDHLEVCFFVNSGTEANELALRLARAHTGAKGMVTPDHG-------- 712 Query: 145 FHGRTFGAISLSTDYEDSKLHFGP--FVPNVASGHSVHKIRYGH-----AEDFVPILE-- 195 +HG T GAI +S ++K GP +V V ++ YG A+ + +++ Sbjct: 713 YHGNTTGAIDISAYKFNAKGGVGPSDWVELVEVADD-YRGTYGRDDPQRAQKYADLVDPA 771 Query: 196 ----SPEGKNVAAIILEPIQGEAGIVVPPADYFPKVSALCRKHNVLLIVDEIQTGIGRTG 251 G VA I E G ++PP Y P V R + I DE+QTG+GR G Sbjct: 772 IAKLQASGHGVAGFIAETFPSVGGQIIPPKGYLPAVYEKIRAAGGICIADEVQTGLGRLG 831 Query: 252 ELLCYDHYKAEAKPDIVLLGKALSGGVLPVSCVLSSHDIMSCFTPG-SHGSTFGGNPLAS 310 E + A PDIV+LGK + G P+ ++++ I F G STFGG+ L+ Sbjct: 832 EYY-FGFEHQGASPDIVVLGKPIGNG-HPLGVLVTTRAIADSFAQGPEFFSTFGGSTLSC 889 Query: 311 RVAIAALEVIRDEKLCQRAAQLGSSFIAQLKALQAKSNGIISEVRGMGLLTAIVIDPSKA 370 R+ L ++ +E L + A Q G+ + L+ LQ++ I +VRGMGL I ++ + Sbjct: 890 RIGTEVLNIVDEEGLQENARQRGADLLNGLRDLQSRHQA-IGDVRGMGLF--IGVELIRT 946 Query: 371 NGKTAWDLCLL----MKDHGLL--AKPTHDHIIRLAPPLVISEEDLQTGVETIAKCID 422 +G A ++C M+DH +L ++ D+I+++ PPL I E G+E I K +D Sbjct: 947 DGSEASEICAYVKNRMRDHRILIGSEGPKDNILKIRPPLTIDAE----GIEMILKTLD 1000 Lambda K H 0.319 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1026 Number of extensions: 56 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 1009 Length adjustment: 38 Effective length of query: 386 Effective length of database: 971 Effective search space: 374806 Effective search space used: 374806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory