Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate PP_0074 PP_0074 shikimate 5-dehydrogenase
Query= BRENDA::Q88RQ5 (274 letters) >FitnessBrowser__Putida:PP_0074 Length = 274 Score = 545 bits (1404), Expect = e-160 Identities = 274/274 (100%), Positives = 274/274 (100%) Query: 1 MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGGNVT 60 MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGGNVT Sbjct: 1 MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGGNVT 60 Query: 61 VPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGK 120 VPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGK Sbjct: 61 VPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGK 120 Query: 121 RILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWLQEP 180 RILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWLQEP Sbjct: 121 RILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWLQEP 180 Query: 181 VDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDGLG 240 VDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDGLG Sbjct: 181 VDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDGLG 240 Query: 241 MLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG 274 MLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG Sbjct: 241 MLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG 274 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 274 Length adjustment: 25 Effective length of query: 249 Effective length of database: 249 Effective search space: 62001 Effective search space used: 62001 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate PP_0074 PP_0074 (shikimate 5-dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.17187.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-83 264.9 0.0 3.8e-83 264.7 0.0 1.0 1 lcl|FitnessBrowser__Putida:PP_0074 PP_0074 shikimate 5-dehydrogenas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_0074 PP_0074 shikimate 5-dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 264.7 0.0 3.8e-83 3.8e-83 3 269 .. 4 271 .. 2 272 .. 0.93 Alignments for each domain: == domain 1 score: 264.7 bits; conditional E-value: 3.8e-83 TIGR00507 3 lgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlellDeiees 77 + v+Gnpi hSksplih +++q+g++leY + ++++e+++ g++++g G nvTvPfKee+++l+D ++++ lcl|FitnessBrowser__Putida:PP_0074 4 YVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGS-GGNVTVPFKEEAFRLCDSLTPR 77 78************************************************95.77******************** PP TIGR00507 78 akligavNTlk.ledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavaleLlka.dkeviiaNRt 149 a+ +gavNTl l dg l g+nTDg Glv +L ++kr+li+GAGGa ++v+ ++l + +++++iaNRt lcl|FitnessBrowser__Putida:PP_0074 78 ARRAGAVNTLSkLADGTLQGDNTDGAGLVRDLTVnAGVELAGKRILILGAGGAVRGVLEPILAHkPQSLVIANRT 152 **********99********************996444445*****************99776559********* PP TIGR00507 150 vekaeelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkaellkeg.klvvDlvynpletpll 223 vekae+la ++ elg ++a + + ++ vd+iinatsa+l ge+ +++ +l+++g ++++D++y + tp+ lcl|FitnessBrowser__Putida:PP_0074 153 VEKAEQLAREFDELGPVVASGFAWL-QEPVDVIINATSASLAGEL--PPIADSLVEAGrTVCYDMMYGKEPTPFC 224 ****************999885554.456****************..9999999988725889************ PP TIGR00507 224 keakkkg.tkvidGlgMlvaQaalsFelwtgvepdvekvfealkekl 269 ++a k+g +kv+dGlgMl +Qaa +F +w+gv pd v l+++l lcl|FitnessBrowser__Putida:PP_0074 225 QWATKLGaAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQL 271 *******99*****************************999998887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (274 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.19 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory