Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate PP_3080 PP_3080 tyr-sensitive phospho-2-dehydro-3-deoxyheptonate aldolase
Query= BRENDA::P00888 (356 letters) >FitnessBrowser__Putida:PP_3080 Length = 353 Score = 360 bits (924), Expect = e-104 Identities = 177/332 (53%), Positives = 232/332 (69%), Gaps = 3/332 (0%) Query: 17 LMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIHDPETALEYARR 76 L +P LK PL + Q+ R++I +I+ GRDPRLLV+ GPCSIHDP +ALEYA R Sbjct: 24 LPSPHLLKQQMPLPSELAQQVQAHRQAIRNILEGRDPRLLVIVGPCSIHDPRSALEYADR 83 Query: 77 FKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQIARKLLLELVN 136 AL EV+D L LVMR Y EKPRTTVGWKGL DPH+DGS D+ +G+ ++R L+L ++ Sbjct: 84 LAALGREVNDKLLLVMRAYVEKPRTTVGWKGLAYDPHLDGSDDMHSGIALSRGLMLSMIE 143 Query: 137 MGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSLAT 196 GLP+ATE L P + Y DL +W+AIGARTTESQ HREM SGL +PVGFKNGTDG +A Sbjct: 144 RGLPIATELLQPMAAGYFDDLLAWAAIGARTTESQIHREMVSGLELPVGFKNGTDGGIAI 203 Query: 197 AINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGG-KAPNYSPADVAQCEKEME 255 A +AMR+AA PHR G++ G A+++T GNPD H++LRGG K PN+ +A + + Sbjct: 204 ASDAMRSAAHPHRHFGMDAQGHPAIIETLGNPDTHLVLRGGHKGPNHDANSIAMARQALA 263 Query: 256 QAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIESNIHEGNQSSEQ 315 +AGL+ +MVDCSH NS KD RQPAV V+ Q G+RS++G+MIE ++ +G Q+ Sbjct: 264 KAGLQARIMVDCSHANSGKDPARQPAVFNDVLEQRLAGDRSLVGVMIEGHLFDGCQA--L 321 Query: 316 PRSEMKYGVSVTDACISWEMTDALLREIHQDL 347 + +KYGVS+TD C+ W T+ LLRE Q L Sbjct: 322 GKGTLKYGVSITDGCLGWASTETLLREAAQKL 353 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 353 Length adjustment: 29 Effective length of query: 327 Effective length of database: 324 Effective search space: 105948 Effective search space used: 105948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate PP_3080 PP_3080 (tyr-sensitive phospho-2-dehydro-3-deoxyheptonate aldolase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.13739.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-137 441.6 0.0 8.4e-137 441.5 0.0 1.0 1 lcl|FitnessBrowser__Putida:PP_3080 PP_3080 tyr-sensitive phospho-2- Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_3080 PP_3080 tyr-sensitive phospho-2-dehydro-3-deoxyheptonate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 441.5 0.0 8.4e-137 8.4e-137 8 337 .. 21 352 .. 14 353 .] 0.98 Alignments for each domain: == domain 1 score: 441.5 bits; conditional E-value: 8.4e-137 TIGR00034 8 idelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkklaeklkddl 82 +l +P+ lk+++pl ++ a++v+ r++i +il+G+d+rllv++GPcsihdp++aleya+rl++l +++d+l lcl|FitnessBrowser__Putida:PP_3080 21 SRRLPSPHLLKQQMPLPSELAQQVQAHRQAIRNILEGRDPRLLVIVGPCSIHDPRSALEYADRLAALGREVNDKL 95 56799********************************************************************** PP TIGR00034 83 eivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatelldtispqyladllswgai 157 +vmr+y+ekPrttvGWkGl dP+l++s d+++G++++r l+l + e glp+atell+++++ y+ dll+w+ai lcl|FitnessBrowser__Putida:PP_3080 96 LLVMRAYVEKPRTTVGWKGLAYDPHLDGSDDMHSGIALSRGLMLSMIERGLPIATELLQPMAAGYFDDLLAWAAI 170 *************************************************************************** PP TIGR00034 158 GarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtkaGqvaivetkGnedghiilrGGk 232 Garttesq+hre+ sgl lpvgfkngtdG++++a da+r+aa++h+ ++++ +G+ ai+et Gn+d+h++lrGG+ lcl|FitnessBrowser__Putida:PP_3080 171 GARTTESQIHREMVSGLELPVGFKNGTDGGIAIASDAMRSAAHPHRHFGMDAQGHPAIIETLGNPDTHLVLRGGH 245 *************************************************************************** PP TIGR00034 233 k.pnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqs 306 k pn+da+++a +++ l kagl++++m+d+sh+ns kd rq++v ++v eq G+++++Gvmie +l +G q lcl|FitnessBrowser__Putida:PP_3080 246 KgPNHDANSIAMARQALAKAGLQARIMVDCSHANSGKDPARQPAVFNDVLEQRLAGDRSLVGVMIEGHLFDGCQA 320 *************************************************************************** PP TIGR00034 307 l.keelkyGksvtdacigwedteallrklaea 337 l k +lkyG+s+td c+gw +te+llr+ a++ lcl|FitnessBrowser__Putida:PP_3080 321 LgKGTLKYGVSITDGCLGWASTETLLREAAQK 352 *7778**********************98875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (353 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.42 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory