Align Cysteine synthase B; CSase B; O-acetylserine (thiol)-lyase B; OAS-TL B; O-acetylserine sulfhydrylase B; EC 2.5.1.47 (characterized)
to candidate PP_1654 PP_1654 cysteine synthase B
Query= SwissProt::P16703 (303 letters) >FitnessBrowser__Putida:PP_1654 Length = 299 Score = 404 bits (1037), Expect = e-117 Identities = 201/290 (69%), Positives = 239/290 (82%) Query: 3 TLEQTIGNTPLVKLQRMGPDNGSEVWLKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPGD 62 T+ +GNTPLV+LQR+ + + + LKLEGNNPAGSVKDR ALSMI AE RG+IKPGD Sbjct: 7 TIADCVGNTPLVRLQRIAGETSNTLLLKLEGNNPAGSVKDRPALSMIARAELRGQIKPGD 66 Query: 63 VLIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGMEGA 122 LIEATSGNTGIALAM AA+KGY+M L+MPDN + ER+AAM AYGAELILVTKE+GMEGA Sbjct: 67 TLIEATSGNTGIALAMAAAIKGYKMILIMPDNSTAERKAAMTAYGAELILVTKEEGMEGA 126 Query: 123 RDLALEMANRGEGKLLDQFNNPDNPYAHYTTTGPEIWQQTGGRITHFVSSMGTTGTITGV 182 RDLA ++ G G +LDQF N DNP AHY +TGPEIWQQT G ITHFVSSMGTTGTI G Sbjct: 127 RDLAEKLQAEGRGLVLDQFANGDNPIAHYNSTGPEIWQQTQGTITHFVSSMGTTGTIMGC 186 Query: 183 SRFMREQSKPVTIVGLQPEEGSSIPGIRRWPTEYLPGIFNASLVDEVLDIHQRDAENTMR 242 S++++EQ+ V I+GLQP EGS+IPGIRRWP EYLP IF+A+ VD V+D+ Q++AE+T R Sbjct: 187 SQYLKEQNPAVQIIGLQPMEGSAIPGIRRWPEEYLPKIFDATRVDRVVDMSQQEAEDTTR 246 Query: 243 ELAVREGIFCGVSSGGAVAGALRVAKANPDAVVVAIICDRGDRYLSTGVF 292 LA EGIFCGVSSGGAVA LR+++ +AV+VAIICDRGDRYLSTG+F Sbjct: 247 RLAREEGIFCGVSSGGAVAAMLRLSREVENAVMVAIICDRGDRYLSTGLF 296 Lambda K H 0.316 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 299 Length adjustment: 27 Effective length of query: 276 Effective length of database: 272 Effective search space: 75072 Effective search space used: 75072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate PP_1654 PP_1654 (cysteine synthase B)
to HMM TIGR01138 (cysM: cysteine synthase B (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01138.hmm # target sequence database: /tmp/gapView.30908.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01138 [M=290] Accession: TIGR01138 Description: cysM: cysteine synthase B Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-166 538.6 0.2 2.4e-166 538.4 0.2 1.0 1 lcl|FitnessBrowser__Putida:PP_1654 PP_1654 cysteine synthase B Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_1654 PP_1654 cysteine synthase B # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 538.4 0.2 2.4e-166 2.4e-166 1 290 [] 7 296 .. 7 296 .. 1.00 Alignments for each domain: == domain 1 score: 538.4 bits; conditional E-value: 2.4e-166 TIGR01138 1 tilklvGntplvrlkrllpeedsevlvklegnnpaGsvkdrpalsmiveaekrGeikeGdvlieatsGntGiala 75 ti+++vGntplvrl+r+++e+++++l+klegnnpaGsvkdrpalsmi +ae+rG+ik+Gd+lieatsGntGiala lcl|FitnessBrowser__Putida:PP_1654 7 TIADCVGNTPLVRLQRIAGETSNTLLLKLEGNNPAGSVKDRPALSMIARAELRGQIKPGDTLIEATSGNTGIALA 81 89************************************************************************* PP TIGR01138 76 mvaalkGykvkllmpdnvseerkaalkayGaelilvdkeeGmeGardlarelvrkgeeklldqfnnpdnpkahyt 150 m+aa+kGyk++l+mpdn+++erkaa++ayGaelilv+keeGmeGardla++l+ +g++ +ldqf+n+dnp ahy+ lcl|FitnessBrowser__Putida:PP_1654 82 MAAAIKGYKMILIMPDNSTAERKAAMTAYGAELILVTKEEGMEGARDLAEKLQAEGRGLVLDQFANGDNPIAHYN 156 *************************************************************************** PP TIGR01138 151 stGieiwqqtkGrithfvsslGttGtimGvsrflkeqnpavqivGlqpaegsaieGlrrieseylpgifdaslvd 225 stG+eiwqqt+G ithfvss+GttGtimG s++lkeqnpavqi+Glqp+egsai+G+rr+++eylp+ifda++vd lcl|FitnessBrowser__Putida:PP_1654 157 STGPEIWQQTQGTITHFVSSMGTTGTIMGCSQYLKEQNPAVQIIGLQPMEGSAIPGIRRWPEEYLPKIFDATRVD 231 *************************************************************************** PP TIGR01138 226 rvvdveqedaediarelakkegifvGvssGgavaaalrlarelekavvvaiicdrGdrylstgvf 290 rvvd+ q++aed+ r+la++egif+GvssGgavaa+lrl+re+e+av+vaiicdrGdrylstg+f lcl|FitnessBrowser__Putida:PP_1654 232 RVVDMSQQEAEDTTRRLAREEGIFCGVSSGGAVAAMLRLSREVENAVMVAIICDRGDRYLSTGLF 296 ***************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (290 nodes) Target sequences: 1 (299 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.39 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory