Align Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 (characterized)
to candidate PP_3827 PP_3827 2-nitropropane dioxygenase
Query= SwissProt::Q7SIB9 (252 letters) >FitnessBrowser__Putida:PP_3827 Length = 361 Score = 37.7 bits (86), Expect = 3e-07 Identities = 37/131 (28%), Positives = 50/131 (38%), Gaps = 22/131 (16%) Query: 110 RPELIRELADHFGAQAVVLAIDARWRGDFPEVHVAGGRVPTGLHAVEWAVKGVELGAGEI 169 RPE++ + HFG L V +G +V + VE A G I Sbjct: 130 RPEVV---SFHFGLPQAEL---------LQRVKASGAKVLSSATTVEEAAWLERNGCDAI 177 Query: 170 LLTSMDRDG----------TKEGYDLRLTRMVAEAVGVPVIASGGAGRMEHFLEAFQAGA 219 + + G T + L VA+AVGVPVIA+GG G L A GA Sbjct: 178 IAMGYEAGGHRGMFLSDDITSQIGTFALVPQVADAVGVPVIAAGGIGDHRGLLAALALGA 237 Query: 220 EAALAASVFHF 230 A + + F Sbjct: 238 SAVQIGTAYLF 248 Score = 28.9 bits (63), Expect = 2e-04 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 2/71 (2%) Query: 42 EAGADELVFLDISATHEERAILLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGADKV 101 EAG +FL T + L V +VA+ V +P+ GG+ L GA V Sbjct: 183 EAGGHRGMFLSDDITSQIGTFAL--VPQVADAVGVPVIAAGGIGDHRGLLAALALGASAV 240 Query: 102 SVNSAAVRRPE 112 + +A + PE Sbjct: 241 QIGTAYLFCPE 251 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 252 Length of database: 361 Length adjustment: 27 Effective length of query: 225 Effective length of database: 334 Effective search space: 75150 Effective search space used: 75150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory