Align Ribose-phosphate pyrophosphokinase; RPPK; EC 2.7.6.1; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase (uncharacterized)
to candidate PP_2744 PP_2744 Ribose-phosphate pyrophosphokinase family protein
Query= curated2:P75044 (328 letters) >FitnessBrowser__Putida:PP_2744 Length = 319 Score = 138 bits (347), Expect = 2e-37 Identities = 97/322 (30%), Positives = 162/322 (50%), Gaps = 22/322 (6%) Query: 7 VVFSLSKTHDLVSRICQKLKMPMGLITHNEFADGETYIRFEESVRNKDVFIFQSTCAPVN 66 ++F+L + D + + Q+L + ++ DGE ESV + V +F S + Sbjct: 7 LLFALQGSQDYGNAVAQRLGRKLSAHEERDYEDGEHKCWPGESVDGRSVIVFHSLYGDAH 66 Query: 67 ----DSLMELLIAIDALKRGSAKSITAILPYYGYARQDRKTMGREPITSKLVADLLTTAG 122 D L LL ALK +A+ +TA+ PY Y R+DRK ++ I ++ VA L+ + G Sbjct: 67 HSAHDKLCRLLFFCGALKDAAARQVTAVTPYLCYGRKDRKVEFQDAIITRHVARLMESCG 126 Query: 123 VSRVALTDIHSDQT-QGFFNIPVDTLRTYHVFLTRTVELLGKKDLVVVSPDYGGVKRARL 181 V R+ D+H+ + IP L+ +F R LLG++ + VVSPD GGVKRA Sbjct: 127 VDRIVALDVHNPSAFDNAYRIPSWNLQCTQLFAQRLAPLLGEQAVTVVSPDIGGVKRAEQ 186 Query: 182 IATSL------ELPLAIIDKRRPAHNVAESINVLGEVANKNCLIVDDMIDTGGTVIAAAK 235 +L + +A+++K R ++ +++G VA ++ DD+I TG T++ AA+ Sbjct: 187 FRQALAHLLARPVSVAMMEKHRQQAGLSGE-HLVGNVAGSTVIVFDDLISTGQTLLRAAQ 245 Query: 236 LLREHHAKKVCVMATHGLFNGEAPQRFQKAFNEGLVDYLFVSNSIPQTKFD-QC-PQFQV 293 R+ A ++ ATHGLF + F+ G + + V++SI + +C Q + Sbjct: 246 ACRQAGASRMLAAATHGLFTTGG-----ELFDSGAFERVLVADSIAPFRLPVRCLEQLDI 300 Query: 294 IDLAPLFEEVLLCYANNSSISA 315 +D + L E+L AN S A Sbjct: 301 VDTSALVAELL---ANRSGPGA 319 Lambda K H 0.323 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 319 Length adjustment: 28 Effective length of query: 300 Effective length of database: 291 Effective search space: 87300 Effective search space used: 87300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate PP_2744 PP_2744 (Ribose-phosphate pyrophosphokinase family protein)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.2663.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-63 198.6 0.0 7.3e-63 198.3 0.0 1.0 1 lcl|FitnessBrowser__Putida:PP_2744 PP_2744 Ribose-phosphate pyropho Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_2744 PP_2744 Ribose-phosphate pyrophosphokinase family protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 198.3 0.0 7.3e-63 7.3e-63 3 297 .. 8 313 .. 7 316 .. 0.91 Alignments for each domain: == domain 1 score: 198.3 bits; conditional E-value: 7.3e-63 TIGR01251 3 ilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiiv...qstsapvndalmellllida 74 +++++ s++ ++va++lg +l e + + dgE + esv+g+ v+++ +++ d+l ll+ + a lcl|FitnessBrowser__Putida:PP_2744 8 LFALQGSQDYGNAVAQRLGRKLSAHEERDYEDGEHKCWPGESVDGRSVIVFHslyGDAHHSAHDKLCRLLFFCGA 82 578899999************************************87777766666678899************* PP TIGR01251 75 lkrasaksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHseq.iqgfFdvpvenlsaspk 148 lk+a a++vtav Py+ Y+R+d+k++ ++i + va+l+e+ G+dr++++d+H++ +++++p nl+ + lcl|FitnessBrowser__Putida:PP_2744 83 LKDAAARQVTAVTPYLCYGRKDRKVEFQDAIITRHVARLMESCGVDRIVALDVHNPSaFDNAYRIPSWNLQCTQL 157 ******************************************************98626899************* PP TIGR01251 149 lieelkkke.lknlvvvsPDkGaverakkvakklg......lelaiieKeRdskenevevtnllgdvegkdvviv 216 ++++l+ + ++vvsPD G+v+ra++++++l +++a++eK+R+ ++ + ++l+g+v+g +v+++ lcl|FitnessBrowser__Putida:PP_2744 158 FAQRLAPLLgEQAVTVVSPDIGGVKRAEQFRQALAhllarpVSVAMMEKHRQ-QA-GLSGEHLVGNVAGSTVIVF 230 ******999889999**************9998752211335789*******.44.7****************** PP TIGR01251 217 DDiisTggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilv.ee..kklpkvseisva 288 DD+isTg Tl++aa++ +++GA++ ++aathg+f+ e +++ +e+v+v+++i+ + + l+++ ++ + lcl|FitnessBrowser__Putida:PP_2744 231 DDLISTGQTLLRAAQACRQAGASRMLAAATHGLFTTG-GELFDSGAFERVLVADSIAPfRLpvRCLEQLDIVDTS 304 **********************************976.5899**************9855467888999999999 PP TIGR01251 289 pliaeaiar 297 l+ae +a+ lcl|FitnessBrowser__Putida:PP_2744 305 ALVAELLAN 313 999999875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (319 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.79 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory