Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate PP_3511 PP_3511 Branched-chain-amino-acid aminotransferase
Query= reanno::pseudo5_N2C3_1:AO356_22970 (339 letters) >lcl|FitnessBrowser__Putida:PP_3511 PP_3511 Branched-chain-amino-acid aminotransferase Length = 339 Score = 585 bits (1507), Expect = e-172 Identities = 283/339 (83%), Positives = 308/339 (90%), Gaps = 1/339 (0%) Query: 1 MGNESINWDKLGFDYIKTDKRYLSHWRDGAWDAGTLTDDNVLHISEGSTALHYGQQCFEG 60 M NESINWDKLGFDYIKTDKRYLS WR+G WD GTLT+DNVLHISEGSTALHYGQQCFEG Sbjct: 1 MSNESINWDKLGFDYIKTDKRYLSVWRNGEWDKGTLTEDNVLHISEGSTALHYGQQCFEG 60 Query: 61 LKAYRCKDGSINLFRPDQNAARMQRSCARLLMPQVETEQFVEACKQVVRANERFIPPYGT 120 LKAYRCKDGSINLFRPDQNAARMQRSCARLLMP V T+ F+EACKQVV+ANE+F+PP+G Sbjct: 61 LKAYRCKDGSINLFRPDQNAARMQRSCARLLMPHVPTDVFIEACKQVVKANEKFVPPHGK 120 Query: 121 GGALYLRPFVIGVGDNIGVRTAPEFIFSIFCIPVGAYFKGGLTPHNFLISSFDRAAPQGT 180 G ALYLRPFVIG GDNIGVRTAPEFIFS+F IPVG+YFKGG+ PHNF ISSFDRAAPQGT Sbjct: 121 G-ALYLRPFVIGTGDNIGVRTAPEFIFSVFAIPVGSYFKGGMKPHNFQISSFDRAAPQGT 179 Query: 181 GAAKVGGNYAASLMPGSQAKKASFADCIYLDPMTHSKIEEVGSANFFGITHDNTFVTPRS 240 GAAKVGGNYAASL PG++AKKA+FAD IYLDP+TH+KIEEVGSANFFGIT +N FVTP+S Sbjct: 180 GAAKVGGNYAASLQPGAEAKKANFADAIYLDPLTHTKIEEVGSANFFGITANNEFVTPKS 239 Query: 241 PSVLPGITRLSLIELAKSRLGLEVIEGDVFIDKLSDFKEAGACGTAAVITPIGGISYKDK 300 SVLPGITRLSL+ELA+SRLG+ VIEGDV I KL F EAGACGTAAVITPIGGI Y K Sbjct: 240 ASVLPGITRLSLMELAQSRLGMTVIEGDVEISKLDRFVEAGACGTAAVITPIGGIEYNGK 299 Query: 301 LHVFHSETEVGPITQKLYKELTGVQTGDVEAPAGWIVKV 339 LHVFH +VGP+TQKLY ELTG+Q+GDVEAPAGWIVKV Sbjct: 300 LHVFHDLEKVGPVTQKLYNELTGIQSGDVEAPAGWIVKV 338 Lambda K H 0.320 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 339 Length adjustment: 28 Effective length of query: 311 Effective length of database: 311 Effective search space: 96721 Effective search space used: 96721 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate PP_3511 PP_3511 (Branched-chain-amino-acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01123.hmm # target sequence database: /tmp/gapView.27056.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-138 447.1 0.0 1.6e-138 447.0 0.0 1.0 1 lcl|FitnessBrowser__Putida:PP_3511 PP_3511 Branched-chain-amino-aci Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_3511 PP_3511 Branched-chain-amino-acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 447.0 0.0 1.6e-138 1.6e-138 1 313 [] 31 338 .. 31 338 .. 0.99 Alignments for each domain: == domain 1 score: 447.0 bits; conditional E-value: 1.6e-138 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeelflealk 75 Wd+++l++++ l+++egs++lhYgq++feGlkayR++dG+i+lfRpd+na+R++rs+ rll+P++++++f+ea+k lcl|FitnessBrowser__Putida:PP_3511 31 WDKGTLTEDNVLHISEGSTALHYGQQCFEGLKAYRCKDGSINLFRPDQNAARMQRSCARLLMPHVPTDVFIEACK 105 *************************************************************************** PP TIGR01123 76 qlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsifveteyvRaapkG 150 q+vka++++vp+++ + +LYlRPf+i+t+dn+Gv++a+e++f+v+a PvG+Yfkgg++p ++f + ++Raap+G lcl|FitnessBrowser__Putida:PP_3511 106 QVVKANEKFVPPHG-KGALYLRPFVIGTGDNIGVRTAPEFIFSVFAIPVGSYFKGGMKP-HNFQISSFDRAAPQG 178 ***********998.999*****************************************.999999********* PP TIGR01123 151 tGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelvttplsesiLegvtresll 225 tGa+kvgGnYaasl++ ++a++ +++d++yldp +++kieevG+an+f+it + + ++tp+s s+L+g+tr sl+ lcl|FitnessBrowser__Putida:PP_3511 179 TGAAKVGGNYAASLQPGAEAKKANFADAIYLDPLTHTKIEEVGSANFFGITAN-NEFVTPKSASVLPGITRLSLM 252 ****************************************************8.99******************* PP TIGR01123 226 elakd.lgleveereiaidelkaaveaGeivfacGtaavitPvgelkiegkevevkse.evGevtkklrdeltdi 298 ela++ lg++v e++++i +l+++veaG acGtaavitP+g+++ +gk +++++ +vG+vt+kl++elt+i lcl|FitnessBrowser__Putida:PP_3511 253 ELAQSrLGMTVIEGDVEISKLDRFVEAG----ACGTAAVITPIGGIEYNGKLHVFHDLeKVGPVTQKLYNELTGI 323 *****9**********************....***********************99769*************** PP TIGR01123 299 qyGkledkegWivev 313 q G++e++ gWiv+v lcl|FitnessBrowser__Putida:PP_3511 324 QSGDVEAPAGWIVKV 338 *************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (339 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.34 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory