Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (characterized)
to candidate PP_3786 PP_3786 aminotransferase
Query= SwissProt::Q58786 (418 letters) >FitnessBrowser__Putida:PP_3786 Length = 402 Score = 184 bits (468), Expect = 3e-51 Identities = 110/290 (37%), Positives = 161/290 (55%), Gaps = 3/290 (1%) Query: 102 DIDPVNEVIHSIGSKPALAYITSAFINPGDVCLMTVPGYPVTATHTKWYGGEVYNLPLLE 161 D P V+ + G+K AL + A I+ GDV L T P YP+ +T + G V +LPLLE Sbjct: 90 DAPPALAVLPTSGAKSALNLLCLALIDTGDVILATTPAYPIFSTIARRMGATVVHLPLLE 149 Query: 162 ENDFLPDLESIPEDIKKRAKILYLNYPNNPTGAQATKKFYKEVVDFAFENEVIVVQDAAY 221 ENDFLPDL + ++ RAK+L +NYPNNPTG A+++ ++ +++++++ DAAY Sbjct: 150 ENDFLPDLHQLSPEVLARAKLLIVNYPNNPTGKVASQQECDRLLAICRDHDILLINDAAY 209 Query: 222 GALVYDGKPLS-FLSVKDAKEVGVEIHSFSKAFNMTGWRLAFLVGNELIIKAFATVKDNF 280 L+ +P FL + A +E+HSFSK+ + GWRL F++ II+A + Sbjct: 210 SDLLPAERPRGRFLYSEGASSHCIEVHSFSKSLQIPGWRLGFILAAPAIIEALGKLSLLH 269 Query: 281 DSGQFIPIQKAGIYCLQHPEITERVRQKYERRLRKMVKILNEVGFKARMPGGTFYLYVKS 340 +SGQ + A L ER+ Q +R MV IL G + GTF++YV+ Sbjct: 270 ESGQPRILLDAVTCILDDRGFAERLCQCIAQRRAVMVDILQAHGLEVLNADGTFFVYVRC 329 Query: 341 PTK-ANGIEFKTAEDFSQYLIKEKLISTVPWDDAG-HYLRLAACFVAKDE 388 P +NG F TA DFSQYL E I T+P+ AG H +R + F + E Sbjct: 330 PAAVSNGRTFATARDFSQYLATELGILTIPYQVAGRHQVRFSVAFCGEAE 379 Lambda K H 0.318 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 402 Length adjustment: 31 Effective length of query: 387 Effective length of database: 371 Effective search space: 143577 Effective search space used: 143577 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory