Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate PP_2077 PP_2077 diaminopimelate decarboxylase
Query= BRENDA::P00861 (420 letters) >FitnessBrowser__Putida:PP_2077 Length = 410 Score = 488 bits (1256), Expect = e-142 Identities = 236/396 (59%), Positives = 300/396 (75%), Gaps = 2/396 (0%) Query: 23 EFGCPVWVYDAQIIRRQIAALKQFDVVRFAQKACSNIHILRLMREQGVKVDSVSLGEIER 82 + G P+W YD + I ++ L FD VRFAQKA N+H+LRLMR G+ +D+VSLGE+ER Sbjct: 14 QHGSPLWAYDTRTIADRVEQLNVFDTVRFAQKANPNLHVLRLMRAHGLVLDAVSLGEMER 73 Query: 83 ALAAGYNPQTHPDDIVFTADVIDQATLERVSELQIPVNAGSVDMLDQLGQVSPGHRVWLR 142 A AAG + P +V T D +D+ TLERV +I VNAGS+DML QLG+ SPGHRVW+R Sbjct: 74 AFAAGASVDGDPAGVVLTCDALDRPTLERVVASKIEVNAGSIDMLHQLGERSPGHRVWIR 133 Query: 143 VNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQRHHLQLVGIHMHIGSGVDYAHLE 202 +NPGFGHGHS+KTNTGGENSKHGIW+ +L AL I+ H L LVG+HMHIGSGVDY HLE Sbjct: 134 INPGFGHGHSRKTNTGGENSKHGIWHEELDEALACIKAHGLHLVGVHMHIGSGVDYQHLE 193 Query: 203 QVCGAMVRQVIEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIARHLGHP 262 QV +M+ + G D++A S GGGLS PY+ ++ VD + Y W AR++I LGHP Sbjct: 194 QVARSMIELIGRLGVDIEAFSIGGGLSTPYRSTDKPVDLQRYAQTWAVARKEIEAMLGHP 253 Query: 263 VKLEIEPGRFLVAQSGVLITQVRSVKQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAA 322 V++EIEPGRFLVA+SG L+ +VR+VKQ+G FV++DAGFNDLMRPAMYG+YH ++ L A Sbjct: 254 VRMEIEPGRFLVAESGYLVAEVRAVKQVGRNTFVIIDAGFNDLMRPAMYGAYHGMTLLDA 313 Query: 323 DGRSLEHAPTVETVVAGPLCESGDVFTQQEGGNVETRALPEVKAGDYLVLHDTGAYGASM 382 DG++++ P TVVAGPLCESGDVFTQ + + + LP+ + GD LV+HD GAYGASM Sbjct: 314 DGQAVDR-PRQPTVVAGPLCESGDVFTQDDQA-LTPQDLPQAQVGDLLVIHDAGAYGASM 371 Query: 383 SSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLALE 418 SSNYNSRPLLPE L +NG R+IRRRQT+++LL+LE Sbjct: 372 SSNYNSRPLLPEFLIENGALRMIRRRQTVQDLLSLE 407 Lambda K H 0.320 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 579 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 420 Length of database: 410 Length adjustment: 31 Effective length of query: 389 Effective length of database: 379 Effective search space: 147431 Effective search space used: 147431 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate PP_2077 PP_2077 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.24905.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-123 398.6 0.0 1.5e-123 398.3 0.0 1.0 1 lcl|FitnessBrowser__Putida:PP_2077 PP_2077 diaminopimelate decarbox Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_2077 PP_2077 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 398.3 0.0 1.5e-123 1.5e-123 16 416 .. 8 407 .. 3 408 .. 0.95 Alignments for each domain: == domain 1 score: 398.3 bits; conditional E-value: 1.5e-123 TIGR01048 16 lkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgldvvsgGEleralaA 90 l+e ++++g+Pl+ yd++t+ r+e+l+ ++ +v +A+KAn nl+vlrl++++Gl ld+vs GE+era aA lcl|FitnessBrowser__Putida:PP_2077 8 LAEAVRQHGSPLWAYDTRTIADRVEQLNVFD-----TVRFAQKANPNLHVLRLMRAHGLVLDAVSLGEMERAFAA 77 567899*********************8776.....59************************************* PP TIGR01048 91 gvk....aekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvllRvnpdvdaktheyis 161 g++ + +v++ ++ ++ +le++++++i+ +n++s+++l++l e ++++ rv++R+np++++ ++ +++ lcl|FitnessBrowser__Putida:PP_2077 78 GASvdgdPAGVVLTCDALDRPTLERVVASKIE-VNAGSIDMLHQLGERSPGH----RVWIRINPGFGHGHSRKTN 147 *9888889***********************9.******************9....******************* PP TIGR01048 162 TGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaekvvklleelkeegieleeldlGG 236 TG ++sK+Gi++e +++ + + +k + l+lvG+h+HIGS++++ + ++a+ +++l+ +l g+++e++++GG lcl|FitnessBrowser__Putida:PP_2077 148 TGGENSKHGIWHE-ELDEALACIKAHGLHLVGVHMHIGSGVDYQHLE-QVARSMIELIGRL---GVDIEAFSIGG 217 *************.6666777888999*************9876655.5566677888885...*********** PP TIGR01048 237 Glgisyeeeeeapdleeyaeklleklekea.elglklklilEpGRslvanagvlltrVesvKevesrkfvlvDag 310 Gl+ +y++ ++++dl+ ya++++ + ++ lg+ +++ +EpGR+lva++g+l+++V++vK+v+ +fv++Dag lcl|FitnessBrowser__Putida:PP_2077 218 GLSTPYRSTDKPVDLQRYAQTWAVARKEIEaMLGHPVRMEIEPGRFLVAESGYLVAEVRAVKQVGRNTFVIIDAG 292 ***************************999899****************************************** PP TIGR01048 311 mndliRpalYeayheiaalkr...leeeetetvdvvGplCEsgDvlakd......relpeveeGdllavasaGAY 376 +ndl+Rpa+Y+ayh +++l++ +++++ + v+GplCEsgDv+++d ++lp+++ Gdll++++aGAY lcl|FitnessBrowser__Putida:PP_2077 293 FNDLMRPAMYGAYHGMTLLDAdgqAVDRPRQPTVVAGPLCESGDVFTQDdqaltpQDLPQAQVGDLLVIHDAGAY 367 ******************987555678899*******************9***999******************* PP TIGR01048 377 gasmssnYnsrprpaevlveegkarlirrretledllale 416 gasmssnYnsrp + e l+e+g +r+irrr+t++dll+le lcl|FitnessBrowser__Putida:PP_2077 368 GASMSSNYNSRPLLPEFLIENGALRMIRRRQTVQDLLSLE 407 *************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (410 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 8.36 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory