Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate PP_4481 PP_4481 Succinylornithine transaminase/acetylornithine aminotransferase
Query= SwissProt::Q88FI7 (416 letters) >FitnessBrowser__Putida:PP_4481 Length = 406 Score = 204 bits (518), Expect = 5e-57 Identities = 141/407 (34%), Positives = 201/407 (49%), Gaps = 46/407 (11%) Query: 21 GRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPHGPYLAL 80 G + VWD G+ IDF GGI V LGHC+PA+V+A+ QA L H + N + P L L Sbjct: 31 GEGSRVWDQSGRELIDFAGGIAVNALGHCHPALVKALTEQANTLWHVS-NVFTNEPALRL 89 Query: 81 MEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARGATG------KRAIIAFDGGFHGRTL 134 +L V ++ NSGAE+ E A K+AR K IIA FHGRTL Sbjct: 90 AHKL---VDATFADRAFFCNSGAESNEAAFKLARRVAHDRFGPQKHEIIATVNSFHGRTL 146 Query: 135 ATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVELAVEDVAAF 194 T+++ G+ Y G + H+PY + ALKA + A Sbjct: 147 FTVSVGGQ-PKYSDGFGPKITGISHVPYNDLE-------ALKAQ--------ISDKTCAV 190 Query: 195 IFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFPRLGIEPDL 254 + EP+QGE G + D A+ + R+ CDE L+I DE+Q+G GRTG +A+ G+ PD+ Sbjct: 191 VIEPIQGESGVVPADKAYLEGARKLCDEHNALLIFDEVQTGVGRTGSLYAYQHYGVIPDI 250 Query: 255 LLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLAQM-TDENLAT 313 L AKS+ GG P+GA++ EL L G G TY GNP+ CA A A L + T E LA Sbjct: 251 LTSAKSLGGGFPIGAMLTTTELAKHLAVGTHGTTYGGNPLGCAVACAVLDVVNTPETLA- 309 Query: 314 WGERQEQAIVSRYERWKA-----SGLSPYIGRLTGVGAMRGIEFANADGSPAPAQLAKVM 368 I +++ER+K ++ GVG + G A A V+ Sbjct: 310 -------GIKAKHERFKTRLEQIGQQYNLFSQVRGVGLLLGCVLTEAWKGKA----KDVL 358 Query: 369 EAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCLAEL 415 AA G++++ +G ++R L +E ++EGLD E+ +A L Sbjct: 359 NAAEKEGVMVLQAGP--DVVRFAPSLVVEDADIDEGLDRFERAVATL 403 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 406 Length adjustment: 31 Effective length of query: 385 Effective length of database: 375 Effective search space: 144375 Effective search space used: 144375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory