Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate PP_5097 PP_5097 homoserine O-acetyltransferase
Query= SwissProt::D7E9E0 (489 letters) >lcl|FitnessBrowser__Putida:PP_5097 PP_5097 homoserine O-acetyltransferase Length = 379 Score = 377 bits (969), Expect = e-109 Identities = 190/368 (51%), Positives = 259/368 (70%), Gaps = 6/368 (1%) Query: 5 SIGNVETKYYQIPEELVLESGKKISDVTLAYETYGTLNWDKSNAILVCHALTGDAHAAGW 64 S+G V + + E L L G+ ++ L YETYGTLN SNA+L+CHAL+G HAAG+ Sbjct: 9 SVGLVVPQTARFDEPLALACGRSLASYELVYETYGTLNASASNAVLICHALSGHHHAAGY 68 Query: 65 HEG-DRKPGWWDIIIGPGKALDTRKYFIICSNVIGGCKGSTGPSSINPDTGESYGLDFPV 123 H DRKPGWWD IGPGK +DT ++F++ N +GGC GSTGPSS+NP TG+ YG DFPV Sbjct: 69 HAATDRKPGWWDSCIGPGKPIDTNRFFVVSLNNLGGCNGSTGPSSVNPATGKPYGADFPV 128 Query: 124 VTIKDMVNAQKKLIDYLGISKLLAVIGGSMGGLQVLQWSVSYPDMVKKAIPIATAGYSTP 183 +T++D V++Q +L + LGI + AV+GGS+GG+Q LQW++SYP+ V+ + IA+A + Sbjct: 129 LTVEDWVHSQVRLGERLGIQQWAAVVGGSLGGMQALQWTISYPERVRHCVDIASAPKLSA 188 Query: 184 QQIAFNEVGRIAIVSDPNWNSGNYYGEKE-PTHGLALARMIGHITYLSDDSMHQKFGRRL 242 Q IAFNEV R AI++DP ++ G++ + P GL LARM+GHITYLSDDSM +KFGR L Sbjct: 189 QNIAFNEVARQAILTDPEFHGGSFQDQGVIPKRGLMLARMVGHITYLSDDSMGEKFGREL 248 Query: 243 Q-DKNEYEFDFSREFEVESYLHYQGLTFTERFDANSYLYLTKAIDYFD--LTENNSLAEG 299 + DK Y+F S EF+VESYL YQG F+ RFDAN+YL +TKA+DYFD T LA Sbjct: 249 KSDKLNYDF-HSVEFQVESYLRYQGEEFSGRFDANTYLLMTKALDYFDPAATHGGDLAAT 307 Query: 300 LKNVEAKFLVISFTSDWLYPPYQLREIVMALSANNADVTYREIESNYGHDSFLLESGQLN 359 L +V A + ++SFT+DW + P + REIV AL A +V Y EI+S YGHD+FL+ + + Sbjct: 308 LAHVTADYCIMSFTTDWRFSPARSREIVDALMAARKNVCYLEIDSPYGHDAFLIPTPRYM 367 Query: 360 YVLNNFLS 367 +N+++ Sbjct: 368 QGFSNYMN 375 Lambda K H 0.316 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 510 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 489 Length of database: 379 Length adjustment: 32 Effective length of query: 457 Effective length of database: 347 Effective search space: 158579 Effective search space used: 158579 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate PP_5097 PP_5097 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.31578.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-143 464.6 0.0 1.2e-143 464.4 0.0 1.0 1 lcl|FitnessBrowser__Putida:PP_5097 PP_5097 homoserine O-acetyltrans Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_5097 PP_5097 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 464.4 0.0 1.2e-143 1.2e-143 2 349 .. 21 373 .. 20 375 .. 0.97 Alignments for each domain: == domain 1 score: 464.4 bits; conditional E-value: 1.2e-143 TIGR01392 2 eeeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk..GWWdellGpgraldtsryf 74 +e+l l +G l ++e++y+tyGtlna+ +Navl+cHal+g++h+ag++ ++d+ GWWd+ +Gpg+++dt+r+f lcl|FitnessBrowser__Putida:PP_5097 21 DEPLALACGRSLASYELVYETYGTLNASASNAVLICHALSGHHHAAGYHAATDRkpGWWDSCIGPGKPIDTNRFF 95 5799*******************************************998777678******************* PP TIGR01392 75 vvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGGmqalewalsy 149 vv+lN+lG+c+GstgP+s+np+tgkpyga+fP++t++D+v+ q +l ++Lg++++aavvGgSlGGmqal+w++sy lcl|FitnessBrowser__Putida:PP_5097 96 VVSLNNLGGCNGSTGPSSVNPATGKPYGADFPVLTVEDWVHSQVRLGERLGIQQWAAVVGGSLGGMQALQWTISY 170 *************************************************************************** PP TIGR01392 150 pervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARmlalltYrseesleerfg 223 perv+++v +a+++++saq+iafnev+rqail+Dpe+++G++++++ P++GL lARm++++tY+s++s+ e+fg lcl|FitnessBrowser__Putida:PP_5097 171 PERVRHCVDIASAPKLSAQNIAFNEVARQAILTDPEFHGGSFQDQGvIPKRGLMLARMVGHITYLSDDSMGEKFG 245 **********************************************9**************************** PP TIGR01392 224 reakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdlargrrdslkealkkikapvlvvgi 298 re ks++ ++ ef+vesylryqg++f rFdAn+Yll+tkald++d a+ + ++l+++l++++a+++++++ lcl|FitnessBrowser__Putida:PP_5097 246 RELKSDKLNYDFHSVEFQVESYLRYQGEEFSGRFDANTYLLMTKALDYFDPAATHGGDLAATLAHVTADYCIMSF 320 *****977777779************************************************************* PP TIGR01392 299 esDllftleeqeelakalkaakle..yaeieseeGHDaFllekekveeliref 349 ++D++f++++++e+++al aa+++ y ei+s++GHDaFl+ + ++++ +++ lcl|FitnessBrowser__Putida:PP_5097 321 TTDWRFSPARSREIVDALMAARKNvcYLEIDSPYGHDAFLIPTPRYMQGFSNY 373 *********************99999***************999888766655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (379 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.09 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory