Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate PP_0691 PP_0691 Glutamate 5-kinase
Query= BRENDA::P0A7B5 (367 letters) >FitnessBrowser__Putida:PP_0691 Length = 372 Score = 296 bits (759), Expect = 5e-85 Identities = 156/359 (43%), Positives = 228/359 (63%), Gaps = 1/359 (0%) Query: 8 VVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPELPA 67 VVK+G+++LT + L+R + V Q L AG +V+V+SGA+AAG LG+ + P+ Sbjct: 12 VVKIGSALLTADGKGLDRGAMAVWVEQMVALREAGVELVLVSSGAVAAGMSQLGWTKRPS 71 Query: 68 TIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDTLRALLDN 127 + Q A++GQ RL+Q WE F +G H Q+LLT D+ DR+R+LNAR TLR L+D Sbjct: 72 AMNELQAAASLGQMRLVQAWESSFGEHGKHTAQILLTHDDLSDRKRYLNARSTLRTLVDL 131 Query: 128 NIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPRSNPQAEL 187 +VPVINEND V T EI+ GDND L+AL A L AD L++LTD+ G++ ADPR+NP+A+L Sbjct: 132 GVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFDADPRNNPEAQL 191 Query: 188 IKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPGVIGDVME 247 I + D +L A+AG + LG GGM TKL+AA +A R+G TII G V+ + Sbjct: 192 IYEARADDPSLDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIIGGRIERVLDRLKA 251 Query: 248 GISVGTLFHAQATPLENRKRWIFG-APPAGEITVDEGATAAILERGSSLLPKGIKSVTGN 306 G +GTL + L RK+W+ G G + +D GA A+ + SLLP G+K+V G+ Sbjct: 252 GERLGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVQALRQANKSLLPVGVKTVQGS 311 Query: 307 FSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVHRDDMI 365 F RGE++ +G ++A G++ Y++ ++I G S+ I++ILGY P VHRD+++ Sbjct: 312 FRRGEMVVCVGPDGVEVARGLANYSALEAQKIIGQSSEAIESILGYSAEPELVHRDNLV 370 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 372 Length adjustment: 30 Effective length of query: 337 Effective length of database: 342 Effective search space: 115254 Effective search space used: 115254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate PP_0691 PP_0691 (Glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.638.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-134 434.6 0.5 1.8e-134 434.4 0.5 1.0 1 lcl|FitnessBrowser__Putida:PP_0691 PP_0691 Glutamate 5-kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_0691 PP_0691 Glutamate 5-kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 434.4 0.5 1.8e-134 1.8e-134 2 362 .. 10 370 .. 9 371 .. 0.99 Alignments for each domain: == domain 1 score: 434.4 bits; conditional E-value: 1.8e-134 TIGR01027 2 riVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaekQalaaVGQ 76 r VvK+Gs++Lt++ + l+r +a veq+ +l++aG e+v+vsSGavaaG+++Lg ++rp ++e Qa+a+ GQ lcl|FitnessBrowser__Putida:PP_0691 10 RWVVKIGSALLTADGKGLDRGAMAVWVEQMVALREAGVELVLVSSGAVAAGMSQLGWTKRPSAMNELQAAASLGQ 84 78************************************************************************* PP TIGR01027 77 grLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvaveeikfGDNDtLsal 151 rL++++e++f ++g+++aQiLLt++dls+r+rylNar+tl++l++lgvvp++NENDtv ++ei+fGDNDtL+al lcl|FitnessBrowser__Putida:PP_0691 85 MRLVQAWESSFGEHGKHTAQILLTHDDLSDRKRYLNARSTLRTLVDLGVVPVINENDTVVTDEIRFGDNDTLAAL 159 *************************************************************************** PP TIGR01027 152 vaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgssvGTGGmrtKleaaelAsragve 226 va+lveAdlLv+ltd dg++dadpr+np+A+li e ++ + +l+avag++g ++G GGm+tKl aa+lA+r+g + lcl|FitnessBrowser__Putida:PP_0691 160 VANLVEADLLVILTDRDGMFDADPRNNPEAQLIYEARADDPSLDAVAGGTGGALGRGGMQTKLRAARLAARSGAH 234 *************************************************************************** PP TIGR01027 227 viiasgekpekiadlledaavgtlfeakkkklknrkqwilaaseakGkiivdegaeeallekgksLlpagvveve 301 +ii+ g+ + + +l +++ +gtl+ +++ l +rkqw++ +++++G++++d+ga++al++ +ksLlp+gv v+ lcl|FitnessBrowser__Putida:PP_0691 235 TIIIGGRIERVLDRLKAGERLGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVQALRQANKSLLPVGVKTVQ 309 *******9999999************************************************************* PP TIGR01027 302 gnFsrgevveilaeegqeigkglvnysseelekikglkseeiedvLgyekkeevvhrdnlv 362 g+F+rge+v ++ ++g e+++gl+nys+ e +ki g++se ie +Lgy+ + e vhrdnlv lcl|FitnessBrowser__Putida:PP_0691 310 GSFRRGEMVVCVGPDGVEVARGLANYSALEAQKIIGQSSEAIESILGYSAEPELVHRDNLV 370 ***********************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.48 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory