Alignments for a candidate for trpB in Pseudomonas putida KT2440

GapMind for Amino acid biosynthesis

Alignments for a candidate for trpB in Pseudomonas putida KT2440

Align candidate PP_0083 PP_0083 (tryptophan synthase beta chain)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00263.hmm
# target sequence database:        /tmp/gapView.15843.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00263  [M=385]
Accession:   TIGR00263
Description: trpB: tryptophan synthase, beta subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   7.2e-197  640.0   0.1   8.2e-197  639.8   0.1    1.0  1  lcl|FitnessBrowser__Putida:PP_0083  PP_0083 tryptophan synthase beta


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Putida:PP_0083  PP_0083 tryptophan synthase beta chain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  639.8   0.1  8.2e-197  8.2e-197       1     384 [.      14     397 ..      14     398 .. 0.99

  Alignments for each domain:
  == domain 1  score: 639.8 bits;  conditional E-value: 8.2e-197
                           TIGR00263   1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiylkredl 75 
                                         g fg+fGG+yv+e+l++ + +l ++ye ak+d++f +el ++ ++y grp pl+fa++l+++ ggaki++kre+l
  lcl|FitnessBrowser__Putida:PP_0083  14 GLFGSFGGRYVAETLMPLVLDLAREYEAAKADPKFLEELAYFQRDYIGRPNPLYFAERLTEHCGGAKIFFKREEL 88 
                                         67************************************************************************* PP

                           TIGR00263  76 lhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqklnvfrmellgak 150
                                         +htGahk+nn +gq+llakr+Gkkr+iaetGaG hGvatat+aa++gl c++ymGa+d+erq+ nvfrm+llga+
  lcl|FitnessBrowser__Putida:PP_0083  89 NHTGAHKVNNCIGQVLLAKRMGKKRLIAETGAGMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAE 163
                                         *************************************************************************** PP

                           TIGR00263 151 vvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeevkeqilekegrlPdaviac 225
                                         +vpvt G+ tlkda+nealrdWvt+vedt+y++G+++GphP+P++vr+fqs+ig+e+++q++ekegrlPd ++ac
  lcl|FitnessBrowser__Putida:PP_0083 164 IVPVTAGTGTLKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKEGRLPDSLVAC 238
                                         *************************************************************************** PP

                           TIGR00263 226 vGGGsnaiGifaafiedeeveligveagGkGidtekhaatlskGkeGvlhGaktkllqdedGqieeahsvsaGld 300
                                         vGGGsna+G+f++f+e+++v++igveagG+G++t+khaa+l+ G +GvlhG++t+llqd+dGqi++ahs+saGld
  lcl|FitnessBrowser__Putida:PP_0083 239 VGGGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHAASLNGGVPGVLHGNRTYLLQDQDGQITDAHSISAGLD 313
                                         *************************************************************************** PP

                           TIGR00263 301 ypgvgPehaalaetgraeyeaitdeealealkllskeeGiipalesshalaaleklapklkkdeivvvnlsGrGd 375
                                         ypg+gPeha+l+e +r+ey++itd+eal+a+++ ++ eGiipalesshala ++k apkl+kd+++vv lsGrGd
  lcl|FitnessBrowser__Putida:PP_0083 314 YPGIGPEHAYLHEVKRVEYVSITDDEALDAFHATCRLEGIIPALESSHALAEAIKRAPKLPKDHLMVVCLSGRGD 388
                                         *************************************************************************** PP

                           TIGR00263 376 kdletvaka 384
                                         kd++tv+++
  lcl|FitnessBrowser__Putida:PP_0083 389 KDMQTVMNH 397
                                         ******986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (385 nodes)
Target sequences:                          1  (405 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 12.47
//
[ok]

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Downloads

Candidates (tab-delimited)
Steps (tab-delimited)
Rules (tab-delimited)
Protein sequences (fasta format)
Organisms (tab-delimited)
SQLite3 databases

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
HMMer finds a hit (regardless of coverage or other bits).

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

our ignorance of proteins' functions,
omissions in the gene models,
frame-shift errors in the genome sequence, or
the organism lacks the pathway.

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

the paper from 2019 on GapMind for amino acid biosynthesis
the paper from 2022 on GapMind for carbon sources
the source code
instructions for running GapMind on your computer
changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory

GapMind for Amino acid biosynthesis