Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate PP_0421 PP_0421 Anthranilate phosphoribosyltransferase
Query= SwissProt::Q8PD71 (345 letters) >FitnessBrowser__Putida:PP_0421 Length = 349 Score = 282 bits (722), Expect = 8e-81 Identities = 159/337 (47%), Positives = 209/337 (62%), Gaps = 4/337 (1%) Query: 6 QQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAATVMR 65 + AL R + ++ +EM ++MRQIM G+ S+A + A L G+R+K E+I EI GA +VMR Sbjct: 4 KSALSRIVGQLDLTTEEMREVMRQIMTGQCSEAQIGAFLMGMRMKSESIDEIVGAVSVMR 63 Query: 66 EFSRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSSKSGSA 125 E + +VE+ +VDIVGTGGDG++ FN+ST + FV AA G VAKHGNR+VS KSGSA Sbjct: 64 ELAEKVELQSLDGVVDIVGTGGDGANIFNVSTASSFVLAAAGCPVAKHGNRAVSGKSGSA 123 Query: 126 DALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNILGPL 185 D LEA G + L P QVA + GIGFM+A HH AMK A RRE+G+RT+FN+LGPL Sbjct: 124 DLLEAAGIYLNLTPTQVARCIDSLGIGFMFAQSHHSAMKHAAGPRRELGLRTLFNMLGPL 183 Query: 186 TNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGELRDG 245 TNPAG + ++GVF L A VLQ LG++ LVV +DG+DE SL A T V EL++ Sbjct: 184 TNPAGVKHQVVGVFAQTLCRPLAEVLQRLGSKHVLVVHSKDGLDEFSLAAPTFVAELKND 243 Query: 246 QVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVP----GPALDIVALNAGAA 301 ++ EY V PED G+ + L V S ++ L A +++ LNAGAA Sbjct: 244 EITEYWVEPEDLGMKSQSLHGLAVESPQASLELIRDALGRRKTENGQKAAEMIVLNAGAA 303 Query: 302 LYVAGVADSIADGIVRARQVLADGSARACLDAYVAFT 338 LY A A S+ G+ A VL G A L AFT Sbjct: 304 LYAADHAMSLKAGVELAHDVLHTGLAWEKLQELGAFT 340 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 349 Length adjustment: 29 Effective length of query: 316 Effective length of database: 320 Effective search space: 101120 Effective search space used: 101120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate PP_0421 PP_0421 (Anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.29869.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-128 413.5 0.8 4e-128 413.3 0.8 1.0 1 lcl|FitnessBrowser__Putida:PP_0421 PP_0421 Anthranilate phosphoribo Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_0421 PP_0421 Anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 413.3 0.8 4e-128 4e-128 2 328 .. 8 337 .. 7 339 .. 0.97 Alignments for each domain: == domain 1 score: 413.3 bits; conditional E-value: 4e-128 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeeseelvDivG 76 ++++ + dL++ee++++m++im+g++s+aqi+A+l+ +r+k+e+++ei+g++ ++re a+kve ++ + +vDivG lcl|FitnessBrowser__Putida:PP_0421 8 SRIVGQLDLTTEEMREVMRQIMTGQCSEAQIGAFLMGMRMKSESIDEIVGAVSVMRELAEKVELQSLDGVVDIVG 82 6788899******************************************************************** PP TIGR01245 77 TGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFlfAPky 151 TGGDg++ +N+STas++v+aaaG +vaKhGnr+vs+ksGsaD+Lea g+ l+l+p++var+++++gigF+fA + lcl|FitnessBrowser__Putida:PP_0421 83 TGGDGANIFNVSTASSFVLAAAGCPVAKHGNRAVSGKSGSADLLEAAGIYLNLTPTQVARCIDSLGIGFMFAQSH 157 *************************************************************************** PP TIGR01245 152 hpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhgedglDEislt 226 h+a+k++a+ R+eLg+rt+fN+LGPL+nPa +k+qv+Gv+ + l++ laevl++lg+k++lvvh++dglDE+sl lcl|FitnessBrowser__Putida:PP_0421 158 HSAMKHAAGPRRELGLRTLFNMLGPLTNPAGVKHQVVGVFAQTLCRPLAEVLQRLGSKHVLVVHSKDGLDEFSLA 232 *************************************************************************** PP TIGR01245 227 getkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevlegke...kkakrdivvlNaaaalyva 298 ++t vaelk++ei+ey ++ped+g+k ++l+ l+++s+++++el++++l ++ +++++++vlNa+aaly+a lcl|FitnessBrowser__Putida:PP_0421 233 APTFVAELKNDEITEYWVEPEDLGMKSQSLHGLAVESPQASLELIRDALGRRKtenGQKAAEMIVLNAGAALYAA 307 *************************************************7665332567889************* PP TIGR01245 299 gkakdlkegvelakeaiksgkalekleelv 328 ++a +lk+gvela++++++g a+ekl+el lcl|FitnessBrowser__Putida:PP_0421 308 DHAMSLKAGVELAHDVLHTGLAWEKLQELG 337 ***************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (349 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.04 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory