Align 3-isopropylmalate dehydratase small subunit 1; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1; EC 4.2.1.33 (characterized)
to candidate 6936141 Sama_0338 isopropylmalate isomerase small subunit (RefSeq)
Query= SwissProt::P04787 (201 letters) >FitnessBrowser__SB2B:6936141 Length = 201 Score = 246 bits (627), Expect = 3e-70 Identities = 120/200 (60%), Positives = 150/200 (75%), Gaps = 1/200 (0%) Query: 3 EKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDEKGQQPNPEFV 62 + FT HTGL V +D+AN+DTD IIPKQFL KVT+ GFG HLF+DWR+LD+ G PNPEF Sbjct: 2 QAFTTHTGLAVAIDSANIDTDQIIPKQFLSKVTKDGFGIHLFHDWRYLDDAGDIPNPEFN 61 Query: 63 LNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLPV 122 LN P Y+GA+ILLA+ENFGCGSSREHAPWAL D+G + +IAP+FADIFYGN+ NN LLPV Sbjct: 62 LNKPRYKGATILLAQENFGCGSSREHAPWALADFGLRAIIAPTFADIFYGNAINNGLLPV 121 Query: 123 TLSDAQVDELFALVKANPGIKFEVDLE-AQVVKAGDKTYSFKIDDFRRHCMLNGLDSIGL 181 L +A V +L V+AN G + VDLE +VV +SF + + R +L GLD+IGL Sbjct: 122 RLPEAAVRQLMDEVEANEGAEVTVDLENLKVVSPSGAEFSFTLAESARQNLLKGLDAIGL 181 Query: 182 TLQHEDAIAAYENKQPAFMR 201 TL HE AI+ YE++ PA+ R Sbjct: 182 TLAHEAAISEYESRIPAWRR 201 Lambda K H 0.321 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 201 Length adjustment: 21 Effective length of query: 180 Effective length of database: 180 Effective search space: 32400 Effective search space used: 32400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate 6936141 Sama_0338 (isopropylmalate isomerase small subunit (RefSeq))
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.20547.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.20547.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.