GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapA in Shewanella amazonensis SB2B

Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate 6937361 Sama_1531 dihydrodipicolinate synthetase family protein (RefSeq)

Query= BRENDA::Q81WN7
         (292 letters)



>lcl|FitnessBrowser__SB2B:6937361 Sama_1531 dihydrodipicolinate
           synthetase family protein (RefSeq)
          Length = 304

 Score =  148 bits (374), Expect = 1e-40
 Identities = 84/286 (29%), Positives = 156/286 (54%)

Query: 2   IDFGTIATAMVTPFDINGNIDFAKTTKLVNYLIDNGTTAIVVGGTTGESPTLTSEEKVAL 61
           +++  +  A+ T F+ +G+I+FA  T+++  LI +G   I+  GT GE+ +L+++EK A 
Sbjct: 3   VNWQGVYPAISTQFNEDGSINFASNTRMLEQLILDGINGIIALGTIGENASLSADEKRAF 62

Query: 62  YRHVVSVVDKRVPVIAGTGSNNTHASIDLTKKATEVGVDAVMLVAPYYNKPSQEGMYQHF 121
            +H V  V  R+PVIAG   N    +I   +    +GVD VML+     + +   +  H+
Sbjct: 63  LKHTVETVAGRIPVIAGCTENTAQLAIQYVQDVEAIGVDGVMLLPAVVYRGTDREVLTHY 122

Query: 122 KAIAESTPLPVMLYNVPGRSIVQISVDTVVRLSEIENIVAIKDAGGDVLTMTEIIEKTAD 181
           + +A +T LP+M+YN P    V I++D    L+   NIVAIK++  D   +TE+  +  D
Sbjct: 123 QMVARATRLPIMIYNNPVSYGVDINLDMTAILANEPNIVAIKESTTDTRRLTELQSRFGD 182

Query: 182 DFAVYSGDDGLTLPAMAVGAKGIVSVASHVIGNEMQEMIAAFQAGEFKKAQKLHQLLVRV 241
            F ++ G D + L ++ +GA G +S  ++V   E   +    +AG  ++A+++++  + +
Sbjct: 183 RFTLFCGVDDIALESLLLGATGWISGLTNVFPRESVTLYKLARAGRMEEAREIYRWFMPL 242

Query: 242 TDSLFMAPSPTPVKTALQMVGLDVGSVRLPLLPLTEEERVTLQSVM 287
                +      +K A Q+ G     VR+P + L  +ER  +++V+
Sbjct: 243 LRLDTIPTLVQCIKFAEQLAGRGSEQVRMPRMTLIGDERAYVENVV 288


Lambda     K      H
   0.316    0.132    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 174
Number of extensions: 4
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 292
Length of database: 304
Length adjustment: 26
Effective length of query: 266
Effective length of database: 278
Effective search space:    73948
Effective search space used:    73948
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 48 (23.1 bits)

Align candidate 6937361 Sama_1531 (dihydrodipicolinate synthetase family protein (RefSeq))
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00674.hmm
# target sequence database:        /tmp/gapView.29244.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00674  [M=286]
Accession:   TIGR00674
Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
    4.5e-67  211.9   0.0    5.1e-67  211.7   0.0    1.0  1  lcl|FitnessBrowser__SB2B:6937361  Sama_1531 dihydrodipicolinate sy


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__SB2B:6937361  Sama_1531 dihydrodipicolinate synthetase family protein (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  211.7   0.0   5.1e-67   5.1e-67       1     283 [.       7     288 ..       7     291 .. 0.98

  Alignments for each domain:
  == domain 1  score: 211.7 bits;  conditional E-value: 5.1e-67
                         TIGR00674   1 gvltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvpviaGtgsn 77 
                                       gv++A+ T f+edgs+ fa+  +++e++i  g+++i+++Gt GE a+Ls +Ek + ++ +ve+v++r+pviaG++ n
  lcl|FitnessBrowser__SB2B:6937361   7 GVYPAISTQFNEDGSINFASNTRMLEQLILDGINGIIALGTIGENASLSADEKRAFLKHTVETVAGRIPVIAGCTEN 83 
                                       5899************************************************************************* PP

                         TIGR00674  78 ateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgvslepetvkrLaeevei 154
                                       + + ai+ ++ +e +gvdgv++   +  + t + ++ h++ +a +++lPi++Yn+P   gv+++ ++++ La+e++i
  lcl|FitnessBrowser__SB2B:6937361  84 TAQLAIQYVQDVEAIGVDGVMLLPAVVYRGTDREVLTHYQMVARATRLPIMIYNNPVSYGVDINLDMTAILANEPNI 160
                                       ***************************************************************************** PP

                         TIGR00674 155 vaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnvapkelkemvkaalegdteeareihq 231
                                       vaiKe+++d +r++e++++ ++ f++++G D ++le l+lGa+G+iS ++nv p+e   ++k a +g++eearei +
  lcl|FitnessBrowser__SB2B:6937361 161 VAIKESTTDTRRLTELQSRFGDRFTLFCGVDDIALESLLLGATGWISGLTNVFPRESVTLYKLARAGRMEEAREIYR 237
                                       ***************************************************************************** PP

                         TIGR00674 232 kllklfkalfietNPipvKtalallgliekdelRlPLtelseekkeklkevl 283
                                        +++l++   i t    +K a +l+g   + ++R+P ++l  +++  +++v+
  lcl|FitnessBrowser__SB2B:6937361 238 WFMPLLRLDTIPTLVQCIKFAEQLAGRGSE-QVRMPRMTLIGDERAYVENVV 288
                                       ******9999999999***********999.*****9999999999999886 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (286 nodes)
Target sequences:                          1  (304 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01
# Mc/sec: 8.66
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory