Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate 6939152 Sama_3250 diaminopimelate decarboxylase (RefSeq)
Query= BRENDA::P56129 (405 letters) >lcl|FitnessBrowser__SB2B:6939152 Sama_3250 diaminopimelate decarboxylase (RefSeq) Length = 414 Score = 320 bits (821), Expect = 4e-92 Identities = 179/389 (46%), Positives = 239/389 (61%), Gaps = 2/389 (0%) Query: 11 HKTPFYLYDFDKIKQAFLNYKEAFKGRKSLICYALKANSNLSILSLLAHLESGADCVSIG 70 H TP Y+Y +++ + + A LICYA+KANSNL++L++LA L SG D VS G Sbjct: 25 HGTPLYVYSRATLERHWHAFDGAVASHPHLICYAVKANSNLAVLNVLARLGSGFDIVSGG 84 Query: 71 EIYRALKAGIKPYRIVFSGVGKSGFEIEQALKLNILFLNVESFMELTTIETIAQSLGIKA 130 E+ R L+AG P ++VFSGVGK+ E+E AL I+ N+ES EL + +A LG A Sbjct: 85 ELSRVLEAGGDPAKVVFSGVGKTVAEMELALNTGIMCFNLESGAELELLNEVAGRLGKVA 144 Query: 131 RISIRINPNIDAKTHPYISTGLKENKFGVGEKEALEMFLWAKKSAFLEPVSVHFHIGSQL 190 +S+R+NP++DA THPYISTGLKENKFG+ +EA +F A L V HIGSQL Sbjct: 145 PVSLRVNPDVDAGTHPYISTGLKENKFGIPMEEAEALFARAAALPNLAVKGVDCHIGSQL 204 Query: 191 SDLEPIIEASQKVAKIAKSLIALGIDLRFFDVGGGIGVSYENEETIKLYDYAQGILNSLQ 250 ++L+P ++A ++ + L GI + FDVGGG+GV+Y E YA IL L Sbjct: 205 TELKPFLDAMDRMLALIDRLAEQGIVIEHFDVGGGLGVTYNGETPPHPDVYAAAILEKLN 264 Query: 251 GLDLTIICEPGRSIVAESGELITQVLYEKKAQNKRFVVVDAGMNDFLRPSLYHAKHAIRV 310 G L +I EPGR+I A +G +TQVLY K +KRFV+VD MND +RPSLY A I + Sbjct: 265 GRPLKLIFEPGRAIAANAGIFVTQVLYTKDNGDKRFVIVDGAMNDLIRPSLYGAWQNI-I 323 Query: 311 ITPSKGREISPCDVVGPVCESSDTFLKDAHLPELEPGDKLVIEKVGAYGSSMASQYNSRP 370 + CDVVGPVCE+ D KD L GD LV+ GAYG +MAS YN+RP Sbjct: 324 PAVKTNEPTTRCDVVGPVCETGDFLGKDREL-AAGSGDLLVVRSAGAYGFTMASNYNTRP 382 Query: 371 KLLELALEDHKIRVIRKREALEDLWRLEE 399 + EL ++ K V+R+RE L LW+ E+ Sbjct: 383 RAAELMVDGDKAYVVREREKLSQLWQGEQ 411 Lambda K H 0.319 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 414 Length adjustment: 31 Effective length of query: 374 Effective length of database: 383 Effective search space: 143242 Effective search space used: 143242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 6939152 Sama_3250 (diaminopimelate decarboxylase (RefSeq))
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.18331.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-162 525.5 0.0 4.7e-162 525.2 0.0 1.0 1 lcl|FitnessBrowser__SB2B:6939152 Sama_3250 diaminopimelate decarb Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6939152 Sama_3250 diaminopimelate decarboxylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 525.2 0.0 4.7e-162 4.7e-162 6 416 .. 8 410 .. 5 411 .. 0.98 Alignments for each domain: == domain 1 score: 525.2 bits; conditional E-value: 4.7e-162 TIGR01048 6 dgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgldvvsgG 82 + +l++e++d++ la+e+gtPlYvy+++tl+++++a++ a++++ +l++YAvKAnsnlavl++la++G+g+d+vsgG lcl|FitnessBrowser__SB2B:6939152 8 EERLFAEECDVAGLAAEHGTPLYVYSRATLERHWHAFDGAVASHPHLICYAVKANSNLAVLNVLARLGSGFDIVSGG 84 56899************************************************************************ PP TIGR01048 83 EleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvllRvnpdvdakthey 159 El r+l+Ag ++ k+vfsg+gk+ +e+e al+++i ++n++s +elell+e+a++lgk a+v+lRvnpdvda th+y lcl|FitnessBrowser__SB2B:6939152 85 ELSRVLEAGGDPAKVVFSGVGKTVAEMELALNTGIMCFNLESGAELELLNEVAGRLGKVAPVSLRVNPDVDAGTHPY 161 ***************************************************************************** PP TIGR01048 160 isTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaekvvklleelkeegieleeldlGG 236 isTGlke+KFGi +eeae+ + +a++l++l + G+++HIGSq+++l+pf +a+++++ l+++l+e+gi +e++d+GG lcl|FitnessBrowser__SB2B:6939152 162 ISTGLKENKFGIPMEEAEALFARAAALPNLAVKGVDCHIGSQLTELKPFLDAMDRMLALIDRLAEQGIVIEHFDVGG 238 ***************************************************************************** PP TIGR01048 237 GlgisyeeeeeapdleeyaeklleklekeaelglklklilEpGRslvanagvlltrVesvKevesrkfvlvDagmnd 313 Glg++y+ e+ +p+++ ya+++lekl++ + lkli+EpGR+++anag+++t+V ++K+++ ++fv+vD++mnd lcl|FitnessBrowser__SB2B:6939152 239 GLGVTYNGET-PPHPDVYAAAILEKLNG-----RPLKLIFEPGRAIAANAGIFVTQVLYTKDNGDKRFVIVDGAMND 309 ********99.***************99.....6******************************************* PP TIGR01048 314 liRpalYeayheiaalkrleeeetetvdvvGplCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprp 390 liRp+lY+a+++i+++ + ++e+t+++dvvGp+CE+gD+l+kdrel + Gdll+v+saGAYg++m+snYn+rpr+ lcl|FitnessBrowser__SB2B:6939152 310 LIRPSLYGAWQNIIPAVK-TNEPTTRCDVVGPVCETGDFLGKDRELAAGS-GDLLVVRSAGAYGFTMASNYNTRPRA 384 ****************66.6677***********************9887.************************** PP TIGR01048 391 aevlveegkarlirrretledllale 416 ae++v+++ka+++r+re+l++l++ e lcl|FitnessBrowser__SB2B:6939152 385 AELMVDGDKAYVVREREKLSQLWQGE 410 ***********************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (414 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.74 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory