Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate 6938533 Sama_2636 4-aminobutyrate aminotransferase (RefSeq)
Query= SwissProt::Q88FI7 (416 letters) >FitnessBrowser__SB2B:6938533 Length = 425 Score = 332 bits (851), Expect = 1e-95 Identities = 169/407 (41%), Positives = 244/407 (59%), Gaps = 3/407 (0%) Query: 5 SISQSIAIVHPITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRL 64 +++ + +HP+ NA VWD +G+ YIDF GGI VLN GH +P V A+ Q + Sbjct: 15 AVAGGVGQIHPVFTERAENATVWDVEGREYIDFAGGIAVLNTGHLHPKVKAAVAEQLEKF 74 Query: 65 THYAFNAAPHGPYLALMEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARGATGKRAIIA 124 +H F + Y+A+ E+L+Q VP + L SG+EA ENA+KVAR T + +IA Sbjct: 75 SHTCFMVLGYESYVAVCEKLNQLVPGDFAKKSALFTSGSEAVENAIKVARAYTKRAGVIA 134 Query: 125 FDGGFHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSV 184 F G+HGRT+A L L GKVAPY + +G + V+ +P A GV+ + A+ +++R+F Sbjct: 135 FTSGYHGRTMAALALTGKVAPYSKGMGLMQANVFRAEFPCALHGVSEDDAMASIERIFKN 194 Query: 185 ELAVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFA 244 + D+AA I EPVQGEGGF A P F + LR CD GI++I DE+Q+G GRTG FA Sbjct: 195 DAEPSDIAAIILEPVQGEGGFYAATPGFMKRLRELCDREGIMLIADEVQTGAGRTGTFFA 254 Query: 245 FPRLGIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLA 304 ++G+ D+ AKSIAGG PL + GR E+M A+ GGLGGTY G+P++CAAALA + Sbjct: 255 MEQMGVAADITTFAKSIAGGFPLSGITGRAEVMDAIGPGGLGGTYGGSPLACAAALAVIE 314 Query: 305 QMTDENLATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEFANADGSPAPAQL 364 +E L Q I S + + P I + G+G+M IE +G PAP Sbjct: 315 VFEEEKLLERSNAIGQTIKSAI--GELASRYPQIAEVRGLGSMIAIELME-NGKPAPEYC 371 Query: 365 AKVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQC 411 +V+ AR RGL+L+ G +++R+L P+T E ++ GL+I+ +C Sbjct: 372 PQVLTEARNRGLILLSCGTYGNVLRILVPITAPDEQIQRGLEIMAEC 418 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 485 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 425 Length adjustment: 32 Effective length of query: 384 Effective length of database: 393 Effective search space: 150912 Effective search space used: 150912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory