Align Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 (characterized)
to candidate 6936141 Sama_0338 isopropylmalate isomerase small subunit (RefSeq)
Query= SwissProt::Q58667 (170 letters) >FitnessBrowser__SB2B:6936141 Length = 201 Score = 69.7 bits (169), Expect = 3e-17 Identities = 49/136 (36%), Positives = 74/136 (54%), Gaps = 22/136 (16%) Query: 13 DVDTDAIIPGPYLR--TTDPYEL-ASHCMAGIDE---------NFPK-KVKEGDVIVAGE 59 ++DTD IIP +L T D + + H +D+ N K + K +++A E Sbjct: 18 NIDTDQIIPKQFLSKVTKDGFGIHLFHDWRYLDDAGDIPNPEFNLNKPRYKGATILLAQE 77 Query: 60 NFGCGSSREQAVIAIKYCGIKAVIAKSFARIFYRNAINVGLIPI---------IANTDEI 110 NFGCGSSRE A A+ G++A+IA +FA IFY NAIN GL+P+ + + E Sbjct: 78 NFGCGSSREHAPWALADFGLRAIIAPTFADIFYGNAINNGLLPVRLPEAAVRQLMDEVEA 137 Query: 111 KDGDIVEIDLDKEEIV 126 +G V +DL+ ++V Sbjct: 138 NEGAEVTVDLENLKVV 153 Lambda K H 0.318 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 86 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 170 Length of database: 201 Length adjustment: 19 Effective length of query: 151 Effective length of database: 182 Effective search space: 27482 Effective search space used: 27482 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory