Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate 6937653 Sama_1805 aromatic amino acid aminotransferase (RefSeq)
Query= BRENDA::A0A140ND68 (396 letters) >FitnessBrowser__SB2B:6937653 Length = 397 Score = 511 bits (1316), Expect = e-149 Identities = 248/396 (62%), Positives = 299/396 (75%) Query: 1 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENE 60 +F + APADPILGL D F+AD R K+NLG+G+YKDE G+TPVL SVK+AE LL E Sbjct: 2 IFSQVVPAPADPILGLTDAFKADPRTDKVNLGVGIYKDEAGQTPVLKSVKQAEAILLAEE 61 Query: 61 TTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSV 120 TKNYLGI+G+ + + QELLFG + N +RA TAQ PGGTGALRVAA+F+ +NT Sbjct: 62 NTKNYLGIEGVTLYNKVVQELLFGATHTVTNQERAVTAQAPGGTGALRVAAEFVVRNTPS 121 Query: 121 KRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGC 180 + +WVSNP+W NH+++F +AGL +EY YYDA NH +DFDA++ SL A GD+VL HGC Sbjct: 122 RVIWVSNPTWANHQNIFETAGLTTKEYGYYDAANHDIDFDAMLRSLEAANQGDLVLLHGC 181 Query: 181 CHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV 240 CHNPTGID TLEQWQ + +L KG +PLFDFAYQGF RG+EEDAEGLR A+M ELI+ Sbjct: 182 CHNPTGIDLTLEQWQKVGELCAAKGLVPLFDFAYQGFGRGIEEDAEGLRLVASMVPELII 241 Query: 241 ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN 300 A+S+SKNFGLYNER+GA TLVAA +E AFSQ+K IRANYSNPPAHGA +V+TILS Sbjct: 242 ANSFSKNFGLYNERIGAVTLVAATAEEAKVAFSQVKRTIRANYSNPPAHGALIVSTILSR 301 Query: 301 DALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR 360 L+A WEQEL +MR+RI MR LFV +L G +DFSFI +Q GMFSFSGL K QV Sbjct: 302 PELKAAWEQELAEMRERIAEMRTLFVESLAAAGVTQDFSFISRQMGMFSFSGLNKAQVEA 361 Query: 361 LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 396 LR E GVY V SGR++VAGMT NM +C AI AVL Sbjct: 362 LRAEHGVYIVGSGRISVAGMTKTNMPVICSAIAAVL 397 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 499 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 397 Length adjustment: 31 Effective length of query: 365 Effective length of database: 366 Effective search space: 133590 Effective search space used: 133590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory