Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate SMc01569 SMc01569 carbamoyl phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >FitnessBrowser__Smeli:SMc01569 Length = 401 Score = 372 bits (954), Expect = e-107 Identities = 198/381 (51%), Positives = 248/381 (65%), Gaps = 10/381 (2%) Query: 4 SALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNV 63 +ALLVL DGT G+ IGATG+ EV FNT++TGYQEILTDPSY QIVT T+PHIGN+ Sbjct: 13 TALLVLADGTVIEGKGIGATGTVQAEVCFNTALTGYQEILTDPSYLGQIVTFTFPHIGNI 72 Query: 64 GTNDADEE----SSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLT 119 G ND D E +++ A G++ + SN+R + L ++LK I+ + IDTR LT Sbjct: 73 GANDEDIEDLTPAARHGAVGVIFKADITEPSNYRAAKHLDAWLKARGIIGLCGIDTRALT 132 Query: 120 RLLREKGAQNGCIIAGDNP---DAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWT 176 +RE G N +IA D D +A+A+ GL G+DLAK T+ ++Y W + W Sbjct: 133 AWIRENGMPNA-VIAHDPAGVFDVEALKAEAKAWSGLEGLDLAKVATSGQSYRWNEKPWV 191 Query: 177 LTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGI 236 G E + +HVVA D+G KRNILR+ CR+T+VPAQTSAE+VL + PDGI Sbjct: 192 WNEGY-STLGETDAAYHVVALDYGVKRNILRLFAGLNCRVTVVPAQTSAEEVLALKPDGI 250 Query: 237 FLSNGPGDPAPC-DYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNH 295 FLSNGPGDPA +YA+ IQ L+TDIPVFGICLGHQ+LALA GA+T KM GHHG NH Sbjct: 251 FLSNGPGDPAATGEYAVPVIQDLLKTDIPVFGICLGHQMLALALGARTEKMHQGHHGANH 310 Query: 296 PVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPE 355 PVKD V I + NHGFAVD +LP + TH SLFDGT G+ +P FS Q HPE Sbjct: 311 PVKDHTTGKVEIVSMNHGFAVDANSLPQGVEQTHISLFDGTNCGLRVDGRPVFSVQHHPE 370 Query: 356 ASPGPHDAAPLFDHFIELIEQ 376 ASPGP D+ LF F+ LI + Sbjct: 371 ASPGPQDSHYLFRRFLNLIRE 391 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 488 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 401 Length adjustment: 31 Effective length of query: 351 Effective length of database: 370 Effective search space: 129870 Effective search space used: 129870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate SMc01569 SMc01569 (carbamoyl phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.32065.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-130 420.1 0.0 3.9e-130 419.9 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc01569 SMc01569 carbamoyl phosphate syn Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc01569 SMc01569 carbamoyl phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 419.9 0.0 3.9e-130 3.9e-130 1 360 [. 14 390 .. 14 391 .. 0.93 Alignments for each domain: == domain 1 score: 419.9 bits; conditional E-value: 3.9e-130 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaesk....ki 71 a lvl+dGtv+egk++ga+++v +ev+FnT++tGYqEiltDpsY gqiv++t p+ign+g n+ed+e + lcl|FitnessBrowser__Smeli:SMc01569 14 ALLVLADGTVIEGKGIGATGTVQAEVCFNTALTGYQEILTDPSYLGQIVTFTFPHIGNIGANDEDIEDLtpaaRH 88 579***************************************************************866222255 PP TIGR01368 72 kvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistekse...keelvekak 143 + g++ k +e+snyra + L+++lk +gi+++ g+DTRal+ +Re+g +avi+++ e l+++ak lcl|FitnessBrowser__Smeli:SMc01569 89 GAVGVIFKADITEPSNYRAAKHLDAWLKARGIIGLCGIDTRALTAWIRENGMPNAVIAHDPAGvfdVEALKAEAK 163 678********************************************************9976666889999999 PP TIGR01368 144 espkvkevnlvkevstkeayeleq.....k.....akkegkklrvvvidlGvKenilreLvkrgvevtvvpadts 208 + +++++l+k ++ + y++++ + +++ ++vv++d+GvK+nilr ++ +++vtvvpa+ts lcl|FitnessBrowser__Smeli:SMc01569 164 AWSGLEGLDLAKVATSGQSYRWNEkpwvwNegystLGETDAAYHVVALDYGVKRNILRLFAGLNCRVTVVPAQTS 238 999********************955555156653444555599******************************* PP TIGR01368 209 aeeikklnpdgillsnGPGdPaav.eeaietvkklleakiPifGIclGhqllalalgaktyklkfGhrGaNhpvk 282 aee+ +l+pdgi+lsnGPGdPaa e+a+ ++ ll+++iP+fGIclGhq+lalalga+t k++ Gh+GaNhpvk lcl|FitnessBrowser__Smeli:SMc01569 239 AEEVLALKPDGIFLSNGPGDPAATgEYAVPVIQDLLKTDIPVFGICLGHQMLALALGARTEKMHQGHHGANHPVK 313 *********************8763778999******************************************** PP TIGR01368 283 dlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdteylFdefve 357 d++tg+vei s NHg+avd +sl+++ +e th +l+Dgt+ gl+ pvfsvQ+HPeaspGp+d++ylF++f++ lcl|FitnessBrowser__Smeli:SMc01569 314 DHTTGKVEIVSMNHGFAVDANSLPQG-VEQTHISLFDGTNCGLRVDGRPVFSVQHHPEASPGPQDSHYLFRRFLN 387 **********************9876.************************************************ PP TIGR01368 358 lik 360 li+ lcl|FitnessBrowser__Smeli:SMc01569 388 LIR 390 997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (401 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 12.63 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory