Align [amino group carrier protein]-C-terminal-L-glutamyl-γ-L-lysine aminotransferase (EC 2.6.1.118; EC 2.6.1.124) (characterized)
to candidate SM_b21186 SM_b21186 4-aminobutyrate aminotransferase
Query= metacyc::MONOMER-18314 (387 letters) >FitnessBrowser__Smeli:SM_b21186 Length = 422 Score = 205 bits (522), Expect = 2e-57 Identities = 138/406 (33%), Positives = 203/406 (50%), Gaps = 38/406 (9%) Query: 5 QLYGDRGLTIVKGEAQYVWDIEGRRYLDFHTGIGVAFLGHRNPIILEYLKNQLENISILS 64 Q+Y DR E +WD EG RY+DF GI V GHR+P ++ +K QL+ + Sbjct: 21 QVYADRA------ENAEIWDKEGNRYIDFAAGIAVVNTGHRHPKVIAAVKAQLDRFTHTC 74 Query: 65 TSFSTPIKD--EMLQALDKVKP-DKMDNAMLLNSGTEAVEAALKTARKITGRKKIIAFKN 121 P ++ + + L+ + P D + + +G EAVE A+K AR TGR+ ++AF Sbjct: 75 HQV-VPYENYVHLAERLNAIVPGDFAKKTIFVTTGAEAVENAVKIARAATGRQAVVAFGG 133 Query: 122 AFHGRTAGSLSVTWNK-KYREPFEPLVG-------PVEFLTFNNIEDLSKIDN------- 166 FHGRT +++T Y+ F + P+E + LS + Sbjct: 134 GFHGRTFMGMALTGKVVPYKVGFGAMPADVFHAPFPIELHGVTVEQSLSALKKLFAADVD 193 Query: 167 --ETAAVIVEPIQGESGVIPANIEFMKALKEKTENTGSLLIFDEIQTGFGRTGKLWAYKH 224 AA+I+EP+QGE G P FMKAL+E + G LLI DE+QTGF RTGKL+A +H Sbjct: 194 PARVAAIIIEPVQGEGGFYPVPTAFMKALREVCDQHGILLIADEVQTGFARTGKLFAMEH 253 Query: 225 YNIVPDILTAGKAIGGGFPVSVVFLPDHIANKLEEGDHGSTYGGNPMAMAAVTAACKVIE 284 + + PD+ T K++ GGFP++ V I + G G TYGGNP+ +AA A VI Sbjct: 254 HGVAPDLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPLGIAAAHAVLDVIA 313 Query: 285 KENVVEQANQKGQQFSNILVKNLADLKVVREVRGKGLMIGI---DIRFQ------PGQVL 335 +EN+ E+ANQ G + L + ++RG G M + D+R +V Sbjct: 314 EENLCERANQLGNRLKQRLAAIREKAPEIVDIRGPGFMNAVEFNDVRTNLPSAEFANKVR 373 Query: 336 KYLQEKGILAVKAG--STVIRFLPSYLITYENMEEASNVLREGLLK 379 EKG++ + G VIRFL I E EA + + +L+ Sbjct: 374 LLALEKGLILLTCGVHGNVIRFLAPITIQDEVFAEALDTIEASILE 419 Lambda K H 0.317 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 422 Length adjustment: 31 Effective length of query: 356 Effective length of database: 391 Effective search space: 139196 Effective search space used: 139196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory