Align Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate SMc02138 SMc02138 acetylornithine transaminase
Query= curated2:Q5JFW3 (362 letters) >FitnessBrowser__Smeli:SMc02138 Length = 399 Score = 264 bits (675), Expect = 3e-75 Identities = 159/376 (42%), Positives = 220/376 (58%), Gaps = 28/376 (7%) Query: 2 PLY----RKRLRLVRGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEKIV 57 PLY R LR RGEGV++ E G RYLD AG+ VN LGHAHP V + Q +K+ Sbjct: 6 PLYDTYLRAPLRFERGEGVWLIAEDGTRYLDFAAGVAVNSLGHAHPHLVEALKAQADKVW 65 Query: 58 VAGPMFEHDEREEMLEELSHWVDYEYVYMGNSGTEAVEAAIKFAR---LATGRSE---IV 111 ++E +E + L+ + V+ NSG EA+E AIK AR A G E ++ Sbjct: 66 HLSNLYEIAGQESLARRLTQVTFADRVFFTNSGAEALECAIKTARRYHFAKGHVEKFHVI 125 Query: 112 AMTNAFHGRTLGSLSATWKKKYREGFGPLVPGFKHIPFNNVEAAKEAITKETAAVIFEPI 171 AFHGRTL +++A ++KY EGFGP PGF +PF ++ A K AI +ETAA++ EPI Sbjct: 126 TFEGAFHGRTLATIAAGGQQKYIEGFGPKAPGFYQVPFGDIGAVKNAINEETAAILVEPI 185 Query: 172 QGEGGIVPADEEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYGVRPDIVTMGK 230 QGEGGI A +EF++ LR+L ++ G LLI DEVQSG+ RTGK A E G++PDI+ + K Sbjct: 186 QGEGGIRTASKEFMQGLRELCDEFGLLLILDEVQSGVGRTGKLFAHEWAGIKPDIMAVAK 245 Query: 231 GIGNGFPVSLTLTD----LEIPRGKHGSTFGGNPLACRAVATTLRILRRDRLVEKAGEKF 286 GIG GFP+ L + G HGST+GGNPLA L ++ + +++ E Sbjct: 246 GIGGGFPLGACLATEAAAAGMVAGTHGSTYGGNPLAMAVGNAVLDVVLAEGFLDQVREVA 305 Query: 287 MEFS----------GERVVKTRGRGLMIGIVLRRPAGNYVKALQERGILVNTAGNRVIRL 336 + F + + + RG GLM+GI + P+ + +KA++ +LV AG V+RL Sbjct: 306 LVFRQGLASLKDRFPDVIEEIRGDGLMLGIKAKVPSADLLKAIRAEKLLVVPAGENVLRL 365 Query: 337 LPPLIIEGDTLEEARK 352 LPPLI T EAR+ Sbjct: 366 LPPLI---TTPAEARE 378 Lambda K H 0.320 0.140 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 399 Length adjustment: 30 Effective length of query: 332 Effective length of database: 369 Effective search space: 122508 Effective search space used: 122508 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory