Align Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 (uncharacterized)
to candidate SMc02791 SMc02791 shikimate 5-dehydrogenase
Query= curated2:Q92TF0 (286 letters) >FitnessBrowser__Smeli:SMc02791 Length = 286 Score = 579 bits (1492), Expect = e-170 Identities = 286/286 (100%), Positives = 286/286 (100%) Query: 1 MHDSRETFVNHAFVTGYPVKHSRSPLIHGHWLKQFGIRGSYRAHEVTPEAFPDFMRQIKE 60 MHDSRETFVNHAFVTGYPVKHSRSPLIHGHWLKQFGIRGSYRAHEVTPEAFPDFMRQIKE Sbjct: 1 MHDSRETFVNHAFVTGYPVKHSRSPLIHGHWLKQFGIRGSYRAHEVTPEAFPDFMRQIKE 60 Query: 61 GRTDFCGGNVTIPHKEAAFRLADRPDELSAELGAANTLWLENGKIRATNTDGRGFVANLD 120 GRTDFCGGNVTIPHKEAAFRLADRPDELSAELGAANTLWLENGKIRATNTDGRGFVANLD Sbjct: 61 GRTDFCGGNVTIPHKEAAFRLADRPDELSAELGAANTLWLENGKIRATNTDGRGFVANLD 120 Query: 121 ERAKGWDRISAAVILGAGGASRAVIQAIRDRGVKTIHVVNRTPERARELADRFGTAVHAH 180 ERAKGWDRISAAVILGAGGASRAVIQAIRDRGVKTIHVVNRTPERARELADRFGTAVHAH Sbjct: 121 ERAKGWDRISAAVILGAGGASRAVIQAIRDRGVKTIHVVNRTPERARELADRFGTAVHAH 180 Query: 181 SMAALPEVVSGAGLFVNTTSLGMDGEPAPAIDFSGLAPDAVVTDIVYVPLKTPLLRQAEE 240 SMAALPEVVSGAGLFVNTTSLGMDGEPAPAIDFSGLAPDAVVTDIVYVPLKTPLLRQAEE Sbjct: 181 SMAALPEVVSGAGLFVNTTSLGMDGEPAPAIDFSGLAPDAVVTDIVYVPLKTPLLRQAEE 240 Query: 241 QGFRIVDGLGMLLHQAVPGFEKWFGLRPVVDETLRQIIISDMDRHA 286 QGFRIVDGLGMLLHQAVPGFEKWFGLRPVVDETLRQIIISDMDRHA Sbjct: 241 QGFRIVDGLGMLLHQAVPGFEKWFGLRPVVDETLRQIIISDMDRHA 286 Lambda K H 0.321 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 286 Length adjustment: 26 Effective length of query: 260 Effective length of database: 260 Effective search space: 67600 Effective search space used: 67600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate SMc02791 SMc02791 (shikimate 5-dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.6088.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-72 227.4 0.0 1.2e-71 227.0 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc02791 SMc02791 shikimate 5-dehydrogena Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc02791 SMc02791 shikimate 5-dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 227.0 0.0 1.2e-71 1.2e-71 5 265 .. 14 277 .. 11 282 .. 0.92 Alignments for each domain: == domain 1 score: 227.0 bits; conditional E-value: 1.2e-71 TIGR00507 5 viGnpikhSksplihnaalkqlgleleYlafeveieelekalsgika..lglkGvnvTvPfKeevlellDeiees 77 v G+p+khS splih + lkq+g+ + Y a+ev++e++++++ +ik+ + G nvT+P+Ke++++l+D+ +e lcl|FitnessBrowser__Smeli:SMc02791 14 VTGYPVKHSRSPLIHGHWLKQFGIRGSYRAHEVTPEAFPDFMRQIKEgrTDFCGGNVTIPHKEAAFRLADRPDEL 88 78*******************************************97436799********************** PP TIGR00507 78 akligavNTlkledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavaleLlka.dkeviiaNRtv 150 +++ga NTl le+gk+ + nTDg G+v++L + + ++i+GAGGa++av+ ++ + k++ ++NRt lcl|FitnessBrowser__Smeli:SMc02791 89 SAELGAANTLWLENGKIRATNTDGRGFVANLDErAKGWDRISAAVILGAGGASRAVIQAIRDRgVKTIHVVNRTP 163 *******************************9976666668899*****************9956899******* PP TIGR00507 151 ekaeelaerlqelgeilalsleevelkk..vdliinatsaglsgeideaevkaellkegklvvDlvynpletpll 223 e+a+ela+r+ + + a s++ +++ l +n+ts+g+ ge ++++ + l+ +++v D+vy pl+tpll lcl|FitnessBrowser__Smeli:SMc02791 164 ERARELADRFGT--AVHAHSMAALPEVVsgAGLFVNTTSLGMDGEP-APAIDFSGLAPDAVVTDIVYVPLKTPLL 235 ***********9..55566666666543349*************98.9*************************** PP TIGR00507 224 keakkkgtkvidGlgMlvaQaalsFelwtgvepdvekvfeal 265 + a+++g +++dGlgMl +Qa+ Fe+w+g p v+++ +++ lcl|FitnessBrowser__Smeli:SMc02791 236 RQAEEQGFRIVDGLGMLLHQAVPGFEKWFGLRPVVDETLRQI 277 *********************************999887765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (286 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.13 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory