Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate SMc01174 SMc01174 cysteine synthase A
Query= BRENDA::P9WP53 (323 letters) >FitnessBrowser__Smeli:SMc01174 Length = 361 Score = 132 bits (333), Expect = 1e-35 Identities = 102/318 (32%), Positives = 152/318 (47%), Gaps = 31/318 (9%) Query: 6 SLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEAD 65 S+L+A+GNTPL+ L+ +S + + K E NP S+KDR A+ +I QAE Sbjct: 21 SVLEAIGNTPLIRLKAVS-------EATGCNILGKAEFLNPGQSVKDRAALWIIRQAEKS 73 Query: 66 GLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFSAA 125 G LRPG I+E T+GNTGI LA+ GYR + V+PE S E++ L L GA+++ A Sbjct: 74 GQLRPGGVIVEGTAGNTGIGLAVVGSALGYRTVIVIPETQSQEKKDALRLLGAELVEVPA 133 Query: 126 EGGSN------TAVATAKELAATNPSW-VMLYQYGNPANTDSHYCGTGPELLADLP-EIT 177 N + A +LA T P+ + Q+ N AN +H T PE+ D ++ Sbjct: 134 VPYRNPNNYVKISGRLAAQLAETEPNGAIWANQFDNVANRQAHVDTTAPEIWRDTDGKVD 193 Query: 178 HFVAGLGTTGTLMGTGRFLREHVANVKIVAAEPR---------YGE----GVYALRNMDE 224 F+ +G+ GTL G LR A +KI A+P +GE G + + Sbjct: 194 GFICAVGSGGTLAGVAEGLRARNAAIKIGIADPEGAALYNFYAHGELKSSGSSITEGIGQ 253 Query: 225 GFVPELYDPEILTARYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAG 284 G + + Y + +AV +L+ EGI G STG + A+ + A G Sbjct: 254 GRITANLEDFTPDFAYQIPDAEAVPYVFDLIEKEGICVGGSTGINIAGAVRL---ARDLG 310 Query: 285 ERADIALVVADAGWKYLS 302 I ++ D G +Y S Sbjct: 311 PGHTIVTILCDYGNRYQS 328 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 361 Length adjustment: 29 Effective length of query: 294 Effective length of database: 332 Effective search space: 97608 Effective search space used: 97608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory