Align Probable adenylyltransferase/sulfurtransferase MoeZ; EC 2.7.7.-; EC 2.8.1.- (characterized)
to candidate SMc02864 SMc02864 molybdopterin biosynthesis protein MoeB
Query= SwissProt::P9WMN7 (392 letters) >FitnessBrowser__Smeli:SMc02864 Length = 254 Score = 279 bits (714), Expect = 5e-80 Identities = 140/247 (56%), Positives = 181/247 (73%), Gaps = 3/247 (1%) Query: 13 SALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGVGTIGIV 72 + L+ E+ARY+RH+++P++G GQ++LK ARVLVIGAGGLGAP L YLAAAGVGT+GIV Sbjct: 5 ATLAPSEIARYARHIVLPEIGGPGQQKLKAARVLVIGAGGLGAPALQYLAAAGVGTLGIV 64 Query: 73 DFDVVDESNLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELRLAPSNAVDLFKQ 132 D DVV SNLQRQVIH AD+GR K +SA +I A+NP ++V H +RL P+NA LF+Q Sbjct: 65 DDDVVSLSNLQRQVIHATADIGRPKVESAAAAIDALNPHVKVVAHPVRLGPANADALFRQ 124 Query: 133 YDLILDGTDNFATRYLVNDAAVLAGKPYVWGSIYRFEGQASV---FWEDAPDGLGVNYRD 189 YDL++DG+DNF TRYL D A AG V G++ RF+G +V + DA +YRD Sbjct: 125 YDLVVDGSDNFDTRYLAADTAEAAGVALVTGAVGRFDGSVTVLKPYGTDAEGHPNPSYRD 184 Query: 190 LYPEPPPPGMVPSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLLVYDALEMSY 249 L+PEPPPPG VP+CAE GVLG + + ++ EAIKL+TGIGE L+GRLL+YDAL + Sbjct: 185 LFPEPPPPGTVPTCAEAGVLGALTGVIGTLQAMEAIKLVTGIGEPLIGRLLLYDALAAQF 244 Query: 250 RTITIRK 256 TI R+ Sbjct: 245 NTIRYRR 251 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 356 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 254 Length adjustment: 27 Effective length of query: 365 Effective length of database: 227 Effective search space: 82855 Effective search space used: 82855 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory