Align histidinol-phosphate aminotransferase (EC 2.6.1.9) (characterized)
to candidate SMc03885 SMc03885 histidinol-phosphate aminotransferase
Query= reanno::Marino:GFF2483 (350 letters) >FitnessBrowser__Smeli:SMc03885 Length = 351 Score = 419 bits (1078), Expect = e-122 Identities = 210/350 (60%), Positives = 263/350 (75%) Query: 1 MSKFWSPLVNDLVPYVPGEQPKMANLVKLNTNENPFGPSPKVIEAIQAELNDGLRLYPDP 60 MSK WSP+V L PYVPGEQP+MA+LVKLNTNE+P+GPS K + AI+A + LRLYPDP Sbjct: 1 MSKLWSPIVAALKPYVPGEQPRMADLVKLNTNESPYGPSEKALGAIRAAADTDLRLYPDP 60 Query: 61 EGESLRETIAAYHKITPEQIFLGNGSDEVLAHIFFGLFQHGEPILFPDITYSFYPVYCGL 120 LR+ IAA H+++ ++F+GNGSDEVLAH F L +H P+LFPDI+YSFY Y GL Sbjct: 61 VALGLRQAIAARHQVSVGEVFVGNGSDEVLAHTFAALLKHDRPLLFPDISYSFYTTYAGL 120 Query: 121 YNIESKKVPLTESFEINPEDFKQPNGGVIFPNPNAPTGRYLELQYVEEILAANPNRVVVV 180 + IE+ +VPL +F I+ D+++P+G VI PNPNAPTG L L +E ++A +P + VV+ Sbjct: 121 FGIEAVEVPLDAAFRIDIADYRRPSGAVILPNPNAPTGIGLPLAEIERLVADHPGQPVVI 180 Query: 181 DEAYIDFGGESAITLVDKYPNLLVSQTLSKARSLAGLRVGFAVGHPDLIEALNRVKNSFN 240 DEAYIDFGGESAI LV KY NLLV QT SK+R+LAGLRVGFA+G LIEAL RVK+SFN Sbjct: 181 DEAYIDFGGESAIALVPKYDNLLVVQTFSKSRALAGLRVGFAIGQRPLIEALERVKDSFN 240 Query: 241 SYPLDRLALAGAKAAYEDEAWFRKCCDGVISERERVTAVLEGLGFEVLPSKANFIFARHK 300 SYPL R A AGA AA EDEAWF +I+ R ++T+ LE GFEVLPS+ANF+FARH Sbjct: 241 SYPLGRAAQAGATAAIEDEAWFEATRGKIIASRAKLTSELEKRGFEVLPSQANFVFARHP 300 Query: 301 EQPGEVLAKGLREQGIIVRHFNKPRISEFLRITIGTVEQNDALIARLESL 350 G+ LA LRE+ +IVRHF KPRI++FLRITIGT + L+A L+ + Sbjct: 301 GHAGQTLAAKLRERAVIVRHFAKPRIADFLRITIGTDAECAKLVAALDEV 350 Lambda K H 0.319 0.139 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 351 Length adjustment: 29 Effective length of query: 321 Effective length of database: 322 Effective search space: 103362 Effective search space used: 103362 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate SMc03885 SMc03885 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.2566.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-89 284.9 0.0 4.5e-89 284.7 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc03885 SMc03885 histidinol-phosphate am Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc03885 SMc03885 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 284.7 0.0 4.5e-89 4.5e-89 4 349 .] 9 350 .. 6 350 .. 0.94 Alignments for each domain: == domain 1 score: 284.7 bits; conditional E-value: 4.5e-89 TIGR01141 4 ikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk.klhrYpdpqalelkealakylgveeenill 77 + +l+pY+pg++ + vkLn+nE+P+gpsek++ a++++++ +l++Ypdp al l++a+a++ +v++ ++++ lcl|FitnessBrowser__Smeli:SMc03885 9 VAALKPYVPGEQPRMA-DLVKLNTNESPYGPSEKALGAIRAAADtDLRLYPDPVALGLRQAIAARHQVSVGEVFV 82 7799*****9777666.5************************999****************************** PP TIGR01141 78 gnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedleavleaakekvklvflasP 152 gnGsde++ + a+l+ + l+++ +ys Y ++a + g+e +evpl++ ++ d ++ + v l +P lcl|FitnessBrowser__Smeli:SMc03885 83 GNGSDEVLAHTFAALLKHDRPLLFPDISYSFYTTYAGLFGIEAVEVPLDAAFRIDIADYR----RPSGAVILPNP 153 ***************************************************977777777....5566789**** PP TIGR01141 153 nnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlvvlrTlSKafgLAglRvGyaianae 227 n+PtG l +eie++++ VV+DeAYi+F +e s++ l+ +y+nl+v++T+SK+ +LAglRvG+ai++ lcl|FitnessBrowser__Smeli:SMc03885 154 NAPTGIGLPLAEIERLVADHPGQPVVIDEAYIDFGGE-SAIALVPKYDNLLVVQTFSKSRALAGLRVGFAIGQRP 227 *******************87899************7.************************************* PP TIGR01141 228 iiealekvrapyn...vsslaleaavaalrdsdkiektveevkkererlleelkkleglevyeSkaNFvlikvke 299 +ieale+v++++n + + a++ a+aa++d++ +e+t +++++r+ l++el+k g+ev +S+aNFv+++ + lcl|FitnessBrowser__Smeli:SMc03885 228 LIEALERVKDSFNsypLGRAAQAGATAAIEDEAWFEATRGKIIASRAKLTSELEKR-GFEVLPSQANFVFARHPG 301 *********98653337889999********************************9.8****************9 PP TIGR01141 300 .daeelleallekgiivRdlksaeglleeclRitvGtreenerllealkei 349 + + l+ +l e+ +ivR++++ + ++lRit+Gt+ e+ +l++al+e+ lcl|FitnessBrowser__Smeli:SMc03885 302 hAGQTLAAKLRERAVIVRHFAKP--RIADFLRITIGTDAECAKLVAALDEV 350 778889999***********954..68*********************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (351 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 12.08 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory