Align Histidinol-phosphatase [alternative form] (EC 3.1.3.15) (characterized)
to candidate SMc04042 SMc04042 monophosphatase
Query= reanno::Phaeo:GFF2154 (250 letters) >FitnessBrowser__Smeli:SMc04042 Length = 259 Score = 234 bits (596), Expect = 2e-66 Identities = 121/247 (48%), Positives = 157/247 (63%), Gaps = 1/247 (0%) Query: 1 MADAARQAILPYFRSAGLQSDNKLDEGFDPVTIADRAAEQAMRSVLSELRPEDSILGEEF 60 +ADAA+ +P FR G NKL+ GFDPVT ADR+AE ++R+++ PE ILGEE Sbjct: 11 LADAAKAETMPRFR-VGTSVLNKLEGGFDPVTEADRSAEASIRALIESSFPEHGILGEEH 69 Query: 61 GETHGQSGRTWVLDPIDGTRGFISGTPTWGVLIALGDADGPFLGIVDQPYIGERFIGTPE 120 G WV+DPIDGTR FISG P WG LI L +G++DQP+ GERF E Sbjct: 70 GNIGLDRELVWVIDPIDGTRAFISGLPVWGTLIGLYRNGKAVMGLMDQPFTGERFFADGE 129 Query: 121 GASLTGPLGHSALVTRATDSLSEATLFTTFPEVGTEAERAAFQRVSAQVRLTRYGMDCYA 180 A GP G L TR +LS+A LFTT P + T + F+ + +VRL RYG DCYA Sbjct: 130 KALYRGPDGERVLATRPCHALSDAVLFTTSPHLYTGELKERFEALQEKVRLFRYGCDCYA 189 Query: 181 YALLAAGQCDLVIEAGLNAYDIQAPIAVIQAAGGVVTNWQGEPAHEGGQVLAAATAELHA 240 +ALLAAG DLV+E GL YD+ I +I+ AGG++T+WQG PA GG+++AA + ELHA Sbjct: 190 FALLAAGHVDLVVECGLKPYDVGGLIPLIEQAGGIITDWQGGPAEMGGEIIAAGSRELHA 249 Query: 241 AALALIQ 247 AL ++ Sbjct: 250 QALEALK 256 Lambda K H 0.317 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 259 Length adjustment: 24 Effective length of query: 226 Effective length of database: 235 Effective search space: 53110 Effective search space used: 53110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate SMc04042 SMc04042 (monophosphatase)
to HMM TIGR02067 (hisN: histidinol-phosphatase (EC 3.1.3.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02067.hmm # target sequence database: /tmp/gapView.32598.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02067 [M=252] Accession: TIGR02067 Description: his_9_HisN: histidinol-phosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-102 327.8 0.0 2.5e-102 327.7 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc04042 SMc04042 monophosphatase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc04042 SMc04042 monophosphatase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 327.7 0.0 2.5e-102 2.5e-102 2 252 .] 5 256 .. 4 256 .. 0.98 Alignments for each domain: == domain 1 score: 327.7 bits; conditional E-value: 2.5e-102 TIGR02067 2 lalalelaeaageailkyfrasdlkvdkksdk.tpVteADraaEeaireliaakfPddgilGEEfgeeeedaeyv 75 ++++++la+aa+++++++fr +++ +k + +pVteADr+aE+ ir+li+++fP++gilGEE+g++ d+e v lcl|FitnessBrowser__Smeli:SMc04042 5 RTFFDRLADAAKAETMPRFRVGTSVLNKLEGGfDPVTEADRSAEASIRALIESSFPEHGILGEEHGNIGLDRELV 79 6899************************99999****************************************** PP TIGR02067 76 WvlDPiDGTksFirGvPvwgtLiaLlekgkpvlGvisqPalgerfvaakgegallng.gerelrvsevaklsdAv 149 Wv+DPiDGT++Fi+G+PvwgtLi+L+++gk+v+G+++qP++gerf+a+ +++ ++ + ger l+++ +++lsdAv lcl|FitnessBrowser__Smeli:SMc04042 80 WVIDPIDGTRAFISGLPVWGTLIGLYRNGKAVMGLMDQPFTGERFFADGEKALYRGPdGERVLATRPCHALSDAV 154 *******************************************************98667*************** PP TIGR02067 150 lvttspkaledeeereafeklrrkarltryggdcyayalvAsGrvdlvveaelspyDiaalipiieeAggvitdw 224 l+ttsp +l + e +e+fe+l++k+rl ryg+dcya+al+A+G+vdlvve++l+pyD+ lip+ie+Agg+itdw lcl|FitnessBrowser__Smeli:SMc04042 155 LFTTSP-HLYTGELKERFEALQEKVRLFRYGCDCYAFALLAAGHVDLVVECGLKPYDVGGLIPLIEQAGGIITDW 228 ******.9******************************************************************* PP TIGR02067 225 kGkeaeeggeavaaanaalhdevlellk 252 +G +ae+gge++aa++++lh+++le+lk lcl|FitnessBrowser__Smeli:SMc04042 229 QGGPAEMGGEIIAAGSRELHAQALEALK 256 *************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (252 nodes) Target sequences: 1 (259 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.47 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory