GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuB in Sinorhizobium meliloti 1021

Align 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (characterized)
to candidate SMc04405 SMc04405 3-isopropylmalate dehydrogenase

Query= BRENDA::P24404
         (370 letters)



>lcl|FitnessBrowser__Smeli:SMc04405 SMc04405 3-isopropylmalate
           dehydrogenase
          Length = 370

 Score =  652 bits (1681), Expect = 0.0
 Identities = 324/370 (87%), Positives = 347/370 (93%)

Query: 1   MTVRSLFLLPGDGIGPEAMTEVRKLIEYMNSAHNAGFTVSEGLVGGSAYDAHGVAISDAD 60
           MTVR+LFLLPGDGIGPEAM EVRK+I YMN+  +AGF   EGLVGGSAYDAHG AIS+ D
Sbjct: 1   MTVRNLFLLPGDGIGPEAMAEVRKIIAYMNAERDAGFVTDEGLVGGSAYDAHGAAISEGD 60

Query: 61  MEKALAADAILFGAVGGPKWDGVPYEHRPEAGLLRLRKDLELFANLRPAICYPALAAASS 120
           M KALAADA+LFGAVGGPKWD VPYE RPEAGLLRLRKDLELFANLRPAICYPALA ASS
Sbjct: 61  MAKALAADAVLFGAVGGPKWDAVPYEVRPEAGLLRLRKDLELFANLRPAICYPALANASS 120

Query: 121 LKPELVEGLDILIVRELTGGVYFGEPKQIIDLGNGQKRGIDTQIYDTFEIERIASVAFEL 180
           LKPELVEGLDILIVRELTGGVYFGEPK+I+DLGNGQKRGIDTQ+YDT+EIERIA VAFEL
Sbjct: 121 LKPELVEGLDILIVRELTGGVYFGEPKEIVDLGNGQKRGIDTQVYDTYEIERIAGVAFEL 180

Query: 181 ARSRDNRVCSMEKRNVMKSGVLWNQVVTETHAAKYKDVQLEHMLADAGGMQLVRKPKQFD 240
           AR+R+NRVCSMEKRNVMKSGVLWNQVVTETH AKY DVQLEHMLADAGGMQLVR+PKQFD
Sbjct: 181 ARTRNNRVCSMEKRNVMKSGVLWNQVVTETHKAKYSDVQLEHMLADAGGMQLVRQPKQFD 240

Query: 241 VIVTDNLFGDMLSDVAAMLTGSLGMLPSASLGAPDAKTGKRKAMYEPVHGSAPDIAGKSI 300
           VIVTDNLFGDMLSDVAAMLTGSLGMLPSASLGAPDAKTGKRKA+YEPVHGSAPDIAG  +
Sbjct: 241 VIVTDNLFGDMLSDVAAMLTGSLGMLPSASLGAPDAKTGKRKALYEPVHGSAPDIAGTGV 300

Query: 301 ANPIAMIASFAMCLRYSFNMVDEATKLEAAIANVLDKGIRTADIMADGCRQVGTSDMGDA 360
           ANPIAMIASFAMCLRYSFN+V EA  LE AIANVLD+GIRT DIMA+GCR+VGT++MGDA
Sbjct: 301 ANPIAMIASFAMCLRYSFNLVKEADDLEKAIANVLDQGIRTGDIMAEGCRKVGTAEMGDA 360

Query: 361 VLAEFKALSA 370
           +LAEFK+LSA
Sbjct: 361 ILAEFKSLSA 370


Lambda     K      H
   0.319    0.135    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 615
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 370
Length of database: 370
Length adjustment: 30
Effective length of query: 340
Effective length of database: 340
Effective search space:   115600
Effective search space used:   115600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate SMc04405 SMc04405 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00169.hmm
# target sequence database:        /tmp/gapView.1758.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00169  [M=349]
Accession:   TIGR00169
Description: leuB: 3-isopropylmalate dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   1.2e-137  444.6   0.0   1.3e-137  444.4   0.0    1.0  1  lcl|FitnessBrowser__Smeli:SMc04405  SMc04405 3-isopropylmalate dehyd


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Smeli:SMc04405  SMc04405 3-isopropylmalate dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  444.4   0.0  1.3e-137  1.3e-137       3     349 .]       7     361 ..       5     361 .. 0.99

  Alignments for each domain:
  == domain 1  score: 444.4 bits;  conditional E-value: 1.3e-137
                           TIGR00169   3 avLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlgavGGpkWd 77 
                                          +LpGDgiGpe +ae  k++  ++ + +  + ++e l+GG a da+g  ++e  ++++ +adavL+gavGGpkWd
  lcl|FitnessBrowser__Smeli:SMc04405   7 FLLPGDGIGPEAMAEVRKIIAYMNAERDAGFVTDEGLVGGSAYDAHGAAISEGDMAKALAADAVLFGAVGGPKWD 81 
                                         68************************************************************************* PP

                           TIGR00169  78 nlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvreLtgGiYfGepkereeaee.e 151
                                         + p +vrPe gLL+lrk+l+lfanLrPa  +++L ++s+lk+e+v+g+D+++vreLtgG+YfGepke+ + ++ +
  lcl|FitnessBrowser__Smeli:SMc04405  82 AVPYEVRPEAGLLRLRKDLELFANLRPAICYPALANASSLKPELVEGLDILIVRELTGGVYFGEPKEIVDLGNgQ 156
                                         *********************************************************************99999* PP

                           TIGR00169 152 kkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeiak.eyPdvelehlyiDnaamq 225
                                         k+++dt++Y ++eieria vafelar+r+++v+s++k nv++s+ lW ++v+e++k +y dv+leh++ D+  mq
  lcl|FitnessBrowser__Smeli:SMc04405 157 KRGIDTQVYDTYEIERIAGVAFELARTRNNRVCSMEKRNVMKSGVLWNQVVTETHKaKYSDVQLEHMLADAGGMQ 231
                                         ********************************************************9****************** PP

                           TIGR00169 226 LvksPeqldvvvtsnlfGDilsDeasvitGslGlLPsaslss......kglalfepvhgsapdiagkgianpiaa 294
                                         Lv++P+q+dv+vt+nlfGD+lsD a+++tGslG+LPsasl+       k++al+epvhgsapdiag g+anpia+
  lcl|FitnessBrowser__Smeli:SMc04405 232 LVRQPKQFDVIVTDNLFGDMLSDVAAMLTGSLGMLPSASLGApdaktgKRKALYEPVHGSAPDIAGTGVANPIAM 306
                                         *****************************************999999999************************* PP

                           TIGR00169 295 ilsaalllryslnleeaaeaieaavkkvleegkrtedlaseattavstkeveeel 349
                                         i s a+ lrys+nl ++a+ +e+a+++vl++g+rt d++ e++ +v+t+e+++ +
  lcl|FitnessBrowser__Smeli:SMc04405 307 IASFAMCLRYSFNLVKEADDLEKAIANVLDQGIRTGDIMAEGCRKVGTAEMGDAI 361
                                         ***************************************************9875 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (349 nodes)
Target sequences:                          1  (370 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.92
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory