GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapA in Sinorhizobium meliloti 1021

Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate SMc02404 SMc02404 dihydrodipicolinate synthase

Query= BRENDA::Q8UGL3
         (294 letters)



>lcl|FitnessBrowser__Smeli:SMc02404 SMc02404 dihydrodipicolinate
           synthase
          Length = 294

 Score =  478 bits (1229), Expect = e-140
 Identities = 235/294 (79%), Positives = 265/294 (90%)

Query: 1   MFKGSIPALITPFTDNGSVDEKAFAAHVEWQIAEGSNGLVPVGTTGESPTLSHDEHKRVV 60
           MFKGSIPAL+TPFT  GSVD  +F AHVEWQI EGS+GLVPVGTTGESPTLSHDEHK+VV
Sbjct: 1   MFKGSIPALVTPFTAAGSVDADSFVAHVEWQIKEGSHGLVPVGTTGESPTLSHDEHKKVV 60

Query: 61  ELCIEVAAKRVPVIAGAGSNNTDEAIELALHAQEAGADALLVVTPYYNKPTQKGLFAHFS 120
           ELC+E +A+RVPVIAGAGSNNT EAIELA HA++AGADA+LVVTPYYNKPTQKGLFAHF+
Sbjct: 61  ELCVEASARRVPVIAGAGSNNTIEAIELAQHAEKAGADAILVVTPYYNKPTQKGLFAHFA 120

Query: 121 AVAEAVKLPIVIYNIPPRSVVDMSPETMGALVKAHKNIIGVKDATGKLDRVSEQRISCGK 180
           A+AE+VKLPIVIYNIP RSVVDMS ETM AL KAH  I+GVKDATG+++RVSEQR++CGK
Sbjct: 121 AIAESVKLPIVIYNIPGRSVVDMSVETMAALAKAHPTIVGVKDATGRIERVSEQRMACGK 180

Query: 181 DFVQLSGEDGTALGFNAHGGVGCISVTANVAPRLCSEFQAAMLAGDYAKALEYQDRLMPL 240
            FVQLSGED TALGFNAHGGVGCISVTANVAPRLC+EFQ A LAG+YAKALE QD+LMPL
Sbjct: 181 AFVQLSGEDATALGFNAHGGVGCISVTANVAPRLCAEFQEATLAGNYAKALELQDKLMPL 240

Query: 241 HRAIFMEPGVCGTKYALSKTRGGNRRVRSPLMSTLEPATEAAIDAALKHAGLMN 294
           H+AIF+EPGVCG KYAL++    +  VRSPL+S LEPAT +AIDAAL+HAGLMN
Sbjct: 241 HKAIFLEPGVCGAKYALNRLGRMSFTVRSPLLSALEPATASAIDAALRHAGLMN 294


Lambda     K      H
   0.317    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 366
Number of extensions: 6
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 294
Length of database: 294
Length adjustment: 26
Effective length of query: 268
Effective length of database: 268
Effective search space:    71824
Effective search space used:    71824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

Align candidate SMc02404 SMc02404 (dihydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00674.hmm
# target sequence database:        /tmp/gapView.11848.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00674  [M=286]
Accession:   TIGR00674
Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
    1.6e-99  318.3   0.1    1.8e-99  318.2   0.1    1.0  1  lcl|FitnessBrowser__Smeli:SMc02404  SMc02404 dihydrodipicolinate syn


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Smeli:SMc02404  SMc02404 dihydrodipicolinate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  318.2   0.1   1.8e-99   1.8e-99       1     280 [.       4     284 ..       4     290 .. 0.96

  Alignments for each domain:
  == domain 1  score: 318.2 bits;  conditional E-value: 1.8e-99
                           TIGR00674   1 gvltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvpviaGtg 75 
                                         g+++Al+TPf + gsvd +++   +e qi++g+ ++v+vGtTGEs+tLs++E+kkv+e+ ve ++ rvpviaG+g
  lcl|FitnessBrowser__Smeli:SMc02404   4 GSIPALVTPFTAAGSVDADSFVAHVEWQIKEGSHGLVPVGTTGESPTLSHDEHKKVVELCVEASARRVPVIAGAG 78 
                                         589************************************************************************ PP

                           TIGR00674  76 snateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgvslepetvkrLae 150
                                         sn+t eaiel+++aek+g+d++lvvtPyYnkPtq+Gl++hf aiae+v+lPi++Yn+P+R++v++++et+++La+
  lcl|FitnessBrowser__Smeli:SMc02404  79 SNNTIEAIELAQHAEKAGADAILVVTPYYNKPTQKGLFAHFAAIAESVKLPIVIYNIPGRSVVDMSVETMAALAK 153
                                         **************************************************************************9 PP

                           TIGR00674 151 eve.ivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnvapkelkemvkaalegdte 224
                                          ++ iv++K+a+g +ervse +   ++ f+ lsG+Da++l + a G+ G iSV++nvap++++e+ +a+l+g+++
  lcl|FitnessBrowser__Smeli:SMc02404 154 AHPtIVGVKDATGRIERVSEQRMACGKAFVQLSGEDATALGFNAHGGVGCISVTANVAPRLCAEFQEATLAGNYA 228
                                         8888*********************************************************************** PP

                           TIGR00674 225 eareihqkllklfkalfietNPipvKtalallgliekdelRlPLte.lseekkeklk 280
                                         +a+e++ kl++l+ka+f+e+   + K+al+ lg +   ++R PL   l+  + + ++
  lcl|FitnessBrowser__Smeli:SMc02404 229 KALELQDKLMPLHKAIFLEPGVCGAKYALNRLGRMSF-TVRSPLLSaLEPATASAID 284
                                         ************************************9.*****86504445555555 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (286 nodes)
Target sequences:                          1  (294 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.86
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory