Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate SMc01096 SMc01096 succinyl-diaminopimelate desuccinylase
Query= BRENDA::Q9KQ52 (377 letters) >FitnessBrowser__Smeli:SMc01096 Length = 397 Score = 286 bits (731), Expect = 9e-82 Identities = 162/390 (41%), Positives = 219/390 (56%), Gaps = 19/390 (4%) Query: 5 PVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFE-----DTTNFWARRGTQ 59 PV LA LI SVTPA+ G + L +GF+++ +V + D N +AR G + Sbjct: 6 PVSNLAA-LIRCPSVTPAEGGALAALEAMLAPVGFKVDRVVAKEPGTPDIENLYARTGGE 64 Query: 60 SPLFVFAGHTDVVPAGPLSQWHTPPFEPTVIDGFLHGRGAADMKGSLACMIVAVERFIAE 119 P +FAGHTDVVP G + W PPF + +G ++GRGA DMKG +AC + AV R I + Sbjct: 65 GPHLMFAGHTDVVPVGDEAAWSRPPFSAAIAEGEMYGRGAVDMKGGIACFVAAVARHIEK 124 Query: 120 HPDHQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGR 179 H +GSI FLIT DEEGP INGTV+++E AR E D C+VGEP++ +GD++K GR Sbjct: 125 HGAPKGSISFLITGDEEGPAINGTVKLLEWAAARGERWDACLVGEPTNPDCIGDMIKIGR 184 Query: 180 RGSITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQ 239 RGS++G + V G QGH AYPHLA+NPV L L +D+G F P++ ++ + Sbjct: 185 RGSLSGRITVHGVQGHAAYPHLADNPVRSILQIAQALMDPPFDDGTENFQPSNLEVTTID 244 Query: 240 AGTGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLD-----------YDVKW 288 G A NVIP + FN RF+ T E + + + LD Y++ W Sbjct: 245 VGNTAVNVIPAKASAAFNIRFNDRWTAESLMAEIVARLDRAAAGSALRPGRAPARYEIVW 304 Query: 289 T-LSGQPFLTDTGELLAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNA 347 FLT L+ ++ AVE V + P L TTGGTSD RFI VVE G V Sbjct: 305 NERPSHVFLTRNNALIDSLSGAVEAVTGRQPQLSTTGGTSDARFIKDY-CPVVEFGLVGK 363 Query: 348 TIHKVNECVRIADLEKLTDMYQKTLNHLLG 377 T+H V+E V +ADLE LT +Y+ + G Sbjct: 364 TMHMVDERVALADLETLTGIYETFIARWFG 393 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 397 Length adjustment: 30 Effective length of query: 347 Effective length of database: 367 Effective search space: 127349 Effective search space used: 127349 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate SMc01096 SMc01096 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.30252.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-128 413.8 0.0 3.7e-128 413.6 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc01096 SMc01096 succinyl-diaminopimelat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc01096 SMc01096 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 413.6 0.0 3.7e-128 3.7e-128 5 369 .. 10 390 .. 7 391 .. 0.96 Alignments for each domain: == domain 1 score: 413.6 bits; conditional E-value: 3.7e-128 TIGR01246 5 akeLisrksvtPndagaqeliaerLkklgfeieilefe.....dtknlwatrgteepvlvfaGhtDvvPaGelek 74 + Li+ +svtP++ ga++ +++ L +gf+++++ + d++nl+a+ g e p+l+faGhtDvvP+G++ + lcl|FitnessBrowser__Smeli:SMc01096 10 LAALIRCPSVTPAEGGALAALEAMLAPVGFKVDRVVAKepgtpDIENLYARTGGEGPHLMFAGHTDVVPVGDEAA 84 5679****************************9987543444489****************************** PP TIGR01246 75 WssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlkerd 149 Ws +pf++++ +G +ygrGa+Dmkg++a+fv+a+ r+++k+ kGs+s+lit Deeg ai+Gt+k++e+ +r lcl|FitnessBrowser__Smeli:SMc01096 85 WSRPPFSAAIAEGEMYGRGAVDMKGGIACFVAAVARHIEKHGAPKGSISFLITGDEEGPAINGTVKLLEWAAARG 159 *************************************************************************** PP TIGR01246 150 elidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffp 224 e d ++vgeP+ + +GD+ikiGrrGs++g+++++G+qGh aYPh+a+nPv +++++ ++l++ +D+G+e f+ lcl|FitnessBrowser__Smeli:SMc01096 160 ERWDACLVGEPTNPDCIGDMIKIGRRGSLSGRITVHGVQGHAAYPHLADNPVRSILQIAQALMDPPFDDGTENFQ 234 *************************************************************************** PP TIGR01246 225 psslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkh...........kldYelewkl.sg 287 ps+l+++ i++g+ a nviP++++++fn+rf+ +++e+l ++++ ld+ Ye+ w+ + lcl|FitnessBrowser__Smeli:SMc01096 235 PSNLEVTTIDVGNTAVNVIPAKASAAFNIRFNDRWTAESLMAEIVARLDRAaagsalrpgraPARYEIVWNErPS 309 *************************************************9989999999888899*****85268 PP TIGR01246 288 epfltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsev 362 + flt+++ li+++ a+e v++++p+lst+GGtsDarfi+++ + vve+Glv +t+h v+e+v ++dle l+ + lcl|FitnessBrowser__Smeli:SMc01096 310 HVFLTRNNALIDSLSGAVEAVTGRQPQLSTTGGTSDARFIKDY-CPVVEFGLVGKTMHMVDERVALADLETLTGI 383 99*****************************************.******************************* PP TIGR01246 363 yekllee 369 ye+++++ lcl|FitnessBrowser__Smeli:SMc01096 384 YETFIAR 390 ***9975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (397 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 10.11 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory