Align prephenate dehydratase (EC 4.2.1.51) (characterized)
to candidate SMc02899 SMc02899 prephenate dehydratase
Query= BRENDA::Q5NLV8 (337 letters) >FitnessBrowser__Smeli:SMc02899 Length = 284 Score = 241 bits (614), Expect = 2e-68 Identities = 132/276 (47%), Positives = 179/276 (64%), Gaps = 7/276 (2%) Query: 57 TKAVAFQGAPGCNSNIAIQDLFPDSLPLPCFSFADALTAVKEGRAGRAMIPIENSLNGRV 116 T ++FQG G NS++A +D+FP PLPC +F DA AV+ G A AMIPIEN++ GRV Sbjct: 5 TNRISFQGDYGANSDMACRDMFPSMEPLPCQTFEDAFLAVENGEADLAMIPIENTIAGRV 64 Query: 117 ADMHFLLPESGLTIQAEYFLPINHCLVAPKGAG--EITHVLSHPQALGQCRHWLQAHNLR 174 AD+H LLPES L I EYF+PI L+ G G EI V SH ALGQCR ++A+ + Sbjct: 65 ADIHHLLPESRLHIVGEYFMPIRFQLMVLPGVGREEIRTVHSHIHALGQCRKIVRANGWK 124 Query: 175 ALAHADTAGAAAEVADRKQAGLAALSPALAAKLYGLEILEKGIADGDTNITRFVVLAEAD 234 + DTAGAA V + +AAL+P LAA LYGL+I+ + + D D+N+TRFVVL+ + Sbjct: 125 PVVAGDTAGAAKLVKEVGDRSMAALAPRLAADLYGLDIIAENVEDTDSNVTRFVVLSREE 184 Query: 235 TALQDLPPIRQNLSGKMMTSLLFTVKNTPSALLNAIKGFGDNQVNMTKLESYQHGASFSA 294 + + R + ++T+ +F V+N P+AL A+ GF N +NMTKLESYQ G F A Sbjct: 185 SRV-----ARTSKDELIITTFVFNVRNIPAALYKAMGGFATNGINMTKLESYQLGGKFVA 239 Query: 295 TQFYADVEGEPSEDNVARALDILQENACDLRILGVY 330 TQFYAD+EG P + V A+D L+ + ++RILG Y Sbjct: 240 TQFYADIEGHPDDIGVRHAMDELRFFSENVRILGTY 275 Lambda K H 0.318 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 284 Length adjustment: 27 Effective length of query: 310 Effective length of database: 257 Effective search space: 79670 Effective search space used: 79670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory