GapMind for Amino acid biosynthesis

 

Aligments for a candidate for serC in Sinorhizobium meliloti 1021

Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate SMc00640 SMc00640 phosphoserine aminotransferase

Query= BRENDA::P52878
         (370 letters)



>lcl|FitnessBrowser__Smeli:SMc00640 SMc00640 phosphoserine
           aminotransferase
          Length = 392

 Score =  482 bits (1241), Expect = e-141
 Identities = 235/379 (62%), Positives = 280/379 (73%), Gaps = 10/379 (2%)

Query: 2   KPTRVPNNPCFSSGPCAKHPGYSIEELKDTPFGRSHRSNLGKEKLAEAIKKTRDMLGLPD 61
           KP   P N  FSSGPCAK PG+++E L D P GRSHR+ +GK KL +AI  TR++L +P 
Sbjct: 6   KPAMRPANTHFSSGPCAKRPGWTLEALSDAPLGRSHRAKIGKTKLKQAIDLTREILEVPA 65

Query: 62  DYLVGIVPASDTGAFEMCLWSMLGCRGVDVLVWESFSKGWATDITKQLKLKDVRVFEAEY 121
           DY +GIVPASDTGA EM LWS+LG RGVD+L WESF  GW TD+ KQLKL DVR  EA+Y
Sbjct: 66  DYRIGIVPASDTGAVEMALWSLLGARGVDMLAWESFGAGWVTDVVKQLKLSDVRRLEADY 125

Query: 122 GKLPDLKKVDFKNDVVFVWNGTTSGVKVPNGDWIPENREGLTLCDATSAIFAMDIPYHKL 181
           G+LPDL KVDF  DVVF WNGTTSGV+VPN D+IP +R+GLT+CDATSA FA  + + KL
Sbjct: 126 GELPDLSKVDFDRDVVFTWNGTTSGVRVPNADFIPADRKGLTICDATSAAFAQALDFAKL 185

Query: 182 DVITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTKGGKLNKKIFEGST 241
           DV+TFSWQKVLGGEGAHG+LILSPRAV+RLE+Y PAWPLPKIFR+TKGGKL + IF G T
Sbjct: 186 DVVTFSWQKVLGGEGAHGVLILSPRAVERLETYVPAWPLPKIFRMTKGGKLIEGIFTGET 245

Query: 242 INTPSMLANEDWLATLKWAESVGGLKPLIQRTNDNLAVFEAFVAKNNWIHFLAETKEIRS 301
           INTPSML  ED++  L WA+SVGGL+ L+ R + N  V   FVA N+WI  LA   E RS
Sbjct: 246 INTPSMLCVEDYIDALLWAKSVGGLEGLMARADANAEVIHRFVAANDWIANLAVKPETRS 305

Query: 302 STSVCFKV----------DLSDEKLKELIKTLEKEKVAYDIGSYRDAPSGLRIWCGATVE 351
           +TSVC K+          D      K ++  LEKE VA+DIG YRDAPSGLRIW GAT+E
Sbjct: 306 NTSVCLKIADNDVSALDADAQAAFAKGVVALLEKEGVAFDIGHYRDAPSGLRIWAGATIE 365

Query: 352 KEDLQCLCEWIEWAYNLVK 370
             D++ L  W+ WA+   K
Sbjct: 366 TSDMEALMPWLAWAFETQK 384


Lambda     K      H
   0.318    0.136    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 485
Number of extensions: 20
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 370
Length of database: 392
Length adjustment: 30
Effective length of query: 340
Effective length of database: 362
Effective search space:   123080
Effective search space used:   123080
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate SMc00640 SMc00640 (phosphoserine aminotransferase)
to HMM TIGR01365 (phosphoserine aminotransferase (EC 2.6.1.52))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01365.hmm
# target sequence database:        /tmp/gapView.4045.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01365  [M=374]
Accession:   TIGR01365
Description: serC_2: phosphoserine aminotransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   3.8e-219  713.2   1.1   4.3e-219  713.0   1.1    1.0  1  lcl|FitnessBrowser__Smeli:SMc00640  SMc00640 phosphoserine aminotran


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Smeli:SMc00640  SMc00640 phosphoserine aminotransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  713.0   1.1  4.3e-219  4.3e-219       1     373 [.      10     382 ..      10     383 .. 1.00

  Alignments for each domain:
  == domain 1  score: 713.0 bits;  conditional E-value: 4.3e-219
                           TIGR01365   1 rpanpefssgpcakrpgysveelknaalgrshrsklgkeklkeaiektrevlevpadyligivaasdtgavemal 75 
                                         rpan +fssgpcakrpg+++e+l +a+lgrshr+k+gk+klk+ai+ tre+levpady+igiv+asdtgavemal
  lcl|FitnessBrowser__Smeli:SMc00640  10 RPANTHFSSGPCAKRPGWTLEALSDAPLGRSHRAKIGKTKLKQAIDLTREILEVPADYRIGIVPASDTGAVEMAL 84 
                                         79************************************************************************* PP

                           TIGR01365  76 wsllgargvdllafesfgkgwvtdvtkqlklkdvrvleaeygklpdlkkvdfkkdvvftwngttsgvrvpngdfi 150
                                         wsllgargvd+la+esfg gwvtdv+kqlkl dvr+lea+yg+lpdl+kvdf++dvvftwngttsgvrvpn+dfi
  lcl|FitnessBrowser__Smeli:SMc00640  85 WSLLGARGVDMLAWESFGAGWVTDVVKQLKLSDVRRLEADYGELPDLSKVDFDRDVVFTWNGTTSGVRVPNADFI 159
                                         *************************************************************************** PP

                           TIGR01365 151 padreglticdatsaafaqdldyekldvvtfswqkvlggegahgvlilspravarlesytpawplpkifrltkgg 225
                                         padr+glticdatsaafaq ld+ kldvvtfswqkvlggegahgvlilsprav+rle+y pawplpkifr+tkgg
  lcl|FitnessBrowser__Smeli:SMc00640 160 PADRKGLTICDATSAAFAQALDFAKLDVVTFSWQKVLGGEGAHGVLILSPRAVERLETYVPAWPLPKIFRMTKGG 234
                                         *************************************************************************** PP

                           TIGR01365 226 klskdifegetintpsmlavedaldalkwaesigglkalvaraddnlavleafvaksswvdflaatkeirsntsv 300
                                         kl+++if getintpsml+ved++dal wa+s+ggl+ l+arad+n++v++ fva ++w+  la+++e+rsntsv
  lcl|FitnessBrowser__Smeli:SMc00640 235 KLIEGIFTGETINTPSMLCVEDYIDALLWAKSVGGLEGLMARADANAEVIHRFVAANDWIANLAVKPETRSNTSV 309
                                         *************************************************************************** PP

                           TIGR01365 301 clkvvdpdvaaldedaqadfakelvsalekegvaydigsyrdapaglriwcgatveksdleallewldwafal 373
                                         clk++d dv+ald+daqa fak++v +lekegva+dig yrdap+glriw gat+e+sd+eal++wl waf++
  lcl|FitnessBrowser__Smeli:SMc00640 310 CLKIADNDVSALDADAQAAFAKGVVALLEKEGVAFDIGHYRDAPSGLRIWAGATIETSDMEALMPWLAWAFET 382
                                         ***********************************************************************87 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (374 nodes)
Target sequences:                          1  (392 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01
# Mc/sec: 8.83
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory