Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate SMa0485 SMa0485 threonine synthase
Query= BRENDA::Q8YFS0 (463 letters) >FitnessBrowser__Smeli:SMa0485 Length = 484 Score = 296 bits (759), Expect = 8e-85 Identities = 176/445 (39%), Positives = 252/445 (56%), Gaps = 18/445 (4%) Query: 1 MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVALAVLT 60 +KYVST G +GF +A+L G A DGGL++P P EQ++A S+ ++A +++ Sbjct: 2 IKYVSTTGGIEPVGFDEAVLQGFAADGGLFVPDRIPVIDQEQLQAFSTLSFQDLAFELVS 61 Query: 61 PFTGGEI-PAADFERMVREAYGTFRHDAVCPLVQTDANE--FVLELFHGPTLAFKDVAMQ 117 + I P D R++ +Y F+ + LV N +VLELFHGPT +FKD+AM Sbjct: 62 LYIDASIIPRQDLRRLIDNSYREFQRPDIVNLVPIRGNRDTYVLELFHGPTQSFKDMAMG 121 Query: 118 LLARMMDYVLAQRGERATIVGATSGDTGGAAIEAFGGRDNTDIFILFPNGRVSPVQQRQM 177 L +++DY+L QR ER IV AT+GDTG AA A G+ D + L+P G +S Q+RQM Sbjct: 122 FLMQVVDYLLGQRRERLNIVLATTGDTGPAAAWAAAGKQRIDCWPLYPRGMISREQERQM 181 Query: 178 TSSGFSNVHALSIEG---NFDDCQNLVKGMFNDLEFCDALSLSGVNSINWARIMPQVVYY 234 T+ NVH + +E DD +V +F+D + L+LS VNSINW R+M Q V+Y Sbjct: 182 TTLRADNVHPVGVENCPDGGDDLDLVVAELFSDEKLKRTLALSSVNSINWCRVMTQTVHY 241 Query: 235 F----TAALSLGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLIIATNDNDILSRTL 290 F A +G P V F+VP+G FG++FAGY+A+ MGLP+ + + A N N+ L Sbjct: 242 FYSYYRAVERVGDP---VVFSVPSGAFGNLFAGYLARSMGLPVARFVCANNVNNALHTAF 298 Query: 291 ESGAYEMRGVAQTTSPSMDIQISSNFERLLFEAHGRDAAAVRGLMQGLKQSGGFTISEKP 350 G + QT S ++DI NF RLL+ A RD A +R M+ + + Sbjct: 299 SRGVLPRHDLVQTPSSAIDIVAPYNFWRLLYFATNRDTARIRQWMKDFAARREVVLDVET 358 Query: 351 LSAIRSEFSAGRSTVDETAATIESVLSKDG-YLLDPHSAI---GVKVAREKASGTAPMVV 406 I+ F + + +ET AT+ SV +G YL+DPH+A+ V+ R+ A +V Sbjct: 359 TKTIQGGFISASISDEETLATVRSVYEAEGHYLIDPHTAVAVAAVEAVRDSLPAAAAIVC 418 Query: 407 LATAHPAKFPDAVKAACGVEPQLPA 431 ATAHPAKFPD +K A VE +LPA Sbjct: 419 FATAHPAKFPDVIKRALDVE-ELPA 442 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 528 Number of extensions: 28 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 484 Length adjustment: 33 Effective length of query: 430 Effective length of database: 451 Effective search space: 193930 Effective search space used: 193930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate SMa0485 SMa0485 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.10328.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-69 220.1 0.0 3.2e-69 219.6 0.0 1.1 1 lcl|FitnessBrowser__Smeli:SMa0485 SMa0485 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMa0485 SMa0485 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 219.6 0.0 3.2e-69 3.2e-69 11 331 .. 69 435 .. 59 442 .. 0.88 Alignments for each domain: == domain 1 score: 219.6 bits; conditional E-value: 3.2e-69 TIGR00260 11 t.ekdlvdlaegstelfrspklaeevga...enlyvkelfhgPtlaFKDrglqfvavlltkalelgne..tvlcAt 80 + +dl l+ s++ f+ p + + v + ++ yv+elfhgPt +FKD+++ f+ +++ ++l++ +e ++ At lcl|FitnessBrowser__Smeli:SMa0485 69 IpRQDLRRLIDNSYREFQRPDIVNLVPIrgnRDTYVLELFHGPTQSFKDMAMGFLMQVVDYLLGQRRErlNIVLAT 144 34679999***************877766699********************************9999999***** PP TIGR00260 81 sGdtgaaaaealagkanvkvvvLyPkgkispv.keklvtalaenakvlaikGdF...Ddaqdlvkeifedke...k 149 +Gdtg+aaa a agk+ +++ LyP+g is + +++t a n++ ++++ Dd +v+e+f+d++ lcl|FitnessBrowser__Smeli:SMa0485 145 TGDTGPAAAWAAAGKQRIDCWPLYPRGMISREqERQMTTLRADNVHPVGVENCPdggDDLDLVVAELFSDEKlkrT 220 ******************************99899***************86541117888899****96555669 PP TIGR00260 150 lklnsvNsinparieaqk.tyafeiveqlgkespdkvvvpvpsgnfgailkGflekkelglpieklaiaaegaadi 224 l l+svNsin+ r+ q y+++ +++ + d vv++vpsg fg++++G+l+ ++ lp +++ a+++++ lcl|FitnessBrowser__Smeli:SMa0485 221 LALSSVNSINWCRVMTQTvHYFYSYYRAVE-RVGDPVVFSVPSGAFGNLFAGYLARSMG-LP-VARFVCANNVNNA 293 ******************777777777777.999******************9999998.**.7788888887777 PP TIGR00260 225 vrrflksgdlepkedk.eTlstAmdignpsnverale.larrslgnledlke........................ 274 ++ +g ++p++d+ +T s A+di p n+ r+l + +r + + + + lcl|FitnessBrowser__Smeli:SMa0485 294 LHTAFSRG-VLPRHDLvQTPSSAIDIVAPYNFWRLLYfATNRDTARIRQWMKdfaarrevvldvettktiqggfis 368 77776777.88888888******************997888888888887668999******************** PP TIGR00260 275 .svsdeeileaikklaeee.gyllephtavavaalkklvekg...vs....atadpaKFeevve.al 331 s+sdee+l +++ ++e e +yl++phtavavaa++ ++ ata+paKF++v+ al lcl|FitnessBrowser__Smeli:SMa0485 369 aSISDEETLATVRSVYEAEgHYLIDPHTAVAVAAVEAVRDSLpaaAAivcfATAHPAKFPDVIKrAL 435 ****************98537*************99888766754115678***********98665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (484 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 14.73 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory