Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate SMc02766 SMc02766 tryptophan synthase subunit beta
Query= uniprot:P50383 (425 letters) >FitnessBrowser__Smeli:SMc02766 Length = 406 Score = 130 bits (326), Expect = 1e-34 Identities = 112/363 (30%), Positives = 166/363 (45%), Gaps = 54/363 (14%) Query: 72 IGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHVVTET 131 IGRP+PL+ A+RL L A+IYFK E TGSHKIN I Q AK G ++ ET Sbjct: 64 IGRPSPLYFAERLTAELGG-AKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAET 122 Query: 132 GAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYASPTNLTEYGRKI 191 GAGQ G A A A+ + + ++M E++ M+L GA V + + Sbjct: 123 GAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEV-----------KPV 171 Query: 192 LETNPQHPGSLGIAMSEAIEYALKN--EFRYLVGSVL------DVVLLHQSVIGQETITQ 243 N G+L AM+EA+ + N YL+G+ ++V Q+VIG+E Q Sbjct: 172 TAGN----GTLKDAMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGEEAKQQ 227 Query: 244 -LDLLGEDADILIGCVGGGSNFGGFTYPFIGNK--------------KGKRYIAVSSAEI 288 L+ G D+++ VGGGSN G + F+ ++ G + A +A Sbjct: 228 ILEAEGRLPDLVVAAVGGGSNAIGIFHSFLDDEGVRIVGVEAGGKGLDGDEHCASLTAGS 287 Query: 289 PKFSKGEYKYDFPDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLTKEGIVE 348 P G Y D G + I+ G D Y G+ P + L G VE Sbjct: 288 PGVLHGNRTYLLQDGDGQIKEGHSISAGLD------------YPGIGPEHAWLNDIGRVE 335 Query: 349 WREYNEREIFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHGL 408 + + E EA + +GI+PA E +HA+ V+ A + K+ ++I+ NLSG G Sbjct: 336 YVPIMDHEALEAFQTLTRLEGIIPALEPSHALAEVIKRAPKMGKD---EIILMNLSGRGD 392 Query: 409 LDL 411 D+ Sbjct: 393 KDI 395 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 406 Length adjustment: 31 Effective length of query: 394 Effective length of database: 375 Effective search space: 147750 Effective search space used: 147750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate SMc02766 SMc02766 (tryptophan synthase subunit beta)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.21058.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-195 636.1 0.0 1.2e-195 636.0 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc02766 SMc02766 tryptophan synthase sub Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc02766 SMc02766 tryptophan synthase subunit beta # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 636.0 0.0 1.2e-195 1.2e-195 1 383 [. 18 400 .. 18 402 .. 0.99 Alignments for each domain: == domain 1 score: 636.0 bits; conditional E-value: 1.2e-195 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiylkredl 75 g+fg fGG++v+e+l++ + +l++++ +ak+d++fk+ele+l +y grp+pl+fa++l+ +lggakiy+kre+l lcl|FitnessBrowser__Smeli:SMc02766 18 GRFGIFGGRFVAETLMPLILDLQDEWARAKNDPAFKAELENLGTHYIGRPSPLYFAERLTAELGGAKIYFKREEL 92 78************************************************************************* PP TIGR00263 76 lhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqklnvfrmellgak 150 +htG+hkinn +gq+llakr+Gk+riiaetGaGqhGva+at+aa++gl c+vymGa+dverq++nvfrm+llga+ lcl|FitnessBrowser__Smeli:SMc02766 93 NHTGSHKINNCIGQILLAKRMGKTRIIAETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAE 167 *************************************************************************** PP TIGR00263 151 vvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeevkeqilekegrlPdaviac 225 v+pvt G+ tlkda+nealrdWvt+v++t+y++G+a+GphP+Pe+vr+fq+vigee+k+qile+egrlPd v+a+ lcl|FitnessBrowser__Smeli:SMc02766 168 VKPVTAGNGTLKDAMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGEEAKQQILEAEGRLPDLVVAA 242 *************************************************************************** PP TIGR00263 226 vGGGsnaiGifaafiedeeveligveagGkGidtekhaatlskGkeGvlhGaktkllqdedGqieeahsvsaGld 300 vGGGsnaiGif++f++de v+++gveagGkG+d ++h+a+l++G++GvlhG++t+llqd dGqi+e hs+saGld lcl|FitnessBrowser__Smeli:SMc02766 243 VGGGSNAIGIFHSFLDDEGVRIVGVEAGGKGLDGDEHCASLTAGSPGVLHGNRTYLLQDGDGQIKEGHSISAGLD 317 *************************************************************************** PP TIGR00263 301 ypgvgPehaalaetgraeyeaitdeealealkllskeeGiipalesshalaaleklapklkkdeivvvnlsGrGd 375 ypg+gPeha+l+++gr+ey+ i d+ealea+++l++ eGiipale shala ++k apk+ kdei+++nlsGrGd lcl|FitnessBrowser__Smeli:SMc02766 318 YPGIGPEHAWLNDIGRVEYVPIMDHEALEAFQTLTRLEGIIPALEPSHALAEVIKRAPKMGKDEIILMNLSGRGD 392 *************************************************************************** PP TIGR00263 376 kdletvak 383 kd++tv k lcl|FitnessBrowser__Smeli:SMc02766 393 KDIFTVGK 400 *****976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (406 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.50 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory