GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvD in Sinorhizobium meliloti 1021

Align Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 (characterized)
to candidate SMc04045 SMc04045 dihydroxy-acid dehydratase

Query= SwissProt::P55186
         (617 letters)



>lcl|FitnessBrowser__Smeli:SMc04045 SMc04045 dihydroxy-acid
           dehydratase
          Length = 612

 Score =  976 bits (2522), Expect = 0.0
 Identities = 490/612 (80%), Positives = 537/612 (87%), Gaps = 4/612 (0%)

Query: 1   MPPYRSRTTTHGRNMAGARGLWRATGMKDEDFGKPIIAVANSFTQFVPGHVHLKDLGQLV 60
           MP YRSRTTTHGRNMAGARGLWRATGMKD DFGKPIIAV NSFTQFVPGHVHLKDLGQLV
Sbjct: 1   MPAYRSRTTTHGRNMAGARGLWRATGMKDSDFGKPIIAVVNSFTQFVPGHVHLKDLGQLV 60

Query: 61  AREIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRDLIADSVEYMVNAHCADAIVCIS 120
           AREIEAAGGVAKEFNTIAVDDGIAMGH GMLYSLPSR++IADSVEYMVNAHCADA+VCIS
Sbjct: 61  AREIEAAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSVEYMVNAHCADAMVCIS 120

Query: 121 NCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKVTVKGKIRALDLVDAMVVAADDSYSDEE 180
           NCDKITPGMLMAA+RLNIP VFVSGGPMEAGKV + GK  ALDLVDAMV AADD  SDE+
Sbjct: 121 NCDKITPGMLMAALRLNIPAVFVSGGPMEAGKVVLHGKTHALDLVDAMVAAADDKVSDED 180

Query: 181 VEAIEKAACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSVLATHADREALFKEAGRVVV 240
           V+ IE++ACPTCGSCSGMFTANSMNCLTEALGLSLPGNGS LATHADR+ LF EAG ++V
Sbjct: 181 VQIIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIV 240

Query: 241 DLCQRWYEQEDATALPRGIATRAAFENAMSLDIAMGGSTNTVLHLLAAAHEGGIDFSMAD 300
           DL +R+YEQED   LPR IAT+ AFENAM+LDIAMGGSTNTVLH+LAAA+EG IDF+M D
Sbjct: 241 DLARRYYEQEDERVLPRNIATKQAFENAMALDIAMGGSTNTVLHILAAAYEGEIDFTMDD 300

Query: 301 IDRLSRHVPCLSKVAPAKSDVHMEDVHRAGGVMAILGELERGGLIDASQPTVHAPTMGEA 360
           IDRLSR VPCLSKVAPAK+DVHMEDVHRAGG+M+ILGEL++GGLI+   PTVHA T+G+A
Sbjct: 301 IDRLSRKVPCLSKVAPAKADVHMEDVHRAGGIMSILGELDKGGLINRDCPTVHAETLGDA 360

Query: 361 LARWDIGRTNSQIAHEFFKAAPGGKPTQVAFSQAARWEELDLDRENGVIRSVEHPFSKDG 420
           + RWDI RT+S    +FF+AAPGG PTQVAFSQ ARW+ELD DRENGVIRSVEHPFSKDG
Sbjct: 361 IDRWDITRTSSDTVRKFFRAAPGGIPTQVAFSQEARWDELDTDRENGVIRSVEHPFSKDG 420

Query: 421 GLAVLFGNLAPEGCIVKTAGVDESILTFRGTARVFESQDAAVSGILGGQVKAGEVVVIRY 480
           GLAVL GN+A +GCIVKTAGVDESIL F G ARVFESQDAAV GIL  ++KAG+VVVIRY
Sbjct: 421 GLAVLKGNIALDGCIVKTAGVDESILKFSGPARVFESQDAAVKGILANEIKAGDVVVIRY 480

Query: 481 EGPKGGPGMQEMLYPTTYLKSKGLGAACALVTDGRFSGGTSGLSIGHVSPEAGEGGLIAL 540
           EGPKGGPGMQEMLYPT+YLKSKGLG ACAL+TDGRFSGGTSGLSIGHVSPEA  GG I L
Sbjct: 481 EGPKGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHVSPEAANGGTIGL 540

Query: 541 VETGDPILIDIPTRGITLEVSDAVLAARREAQLARGKDAWTPL-NRKRDLTPALRAYAAM 599
           V  GD I IDIP R I+L V +A LAARR  Q A+G   W P+  RKR +T AL+AYAA 
Sbjct: 541 VREGDMIDIDIPNRTISLRVDEAELAARRTEQDAKG---WKPVEQRKRRVTTALKAYAAF 597

Query: 600 TTNAARGAVRDV 611
            T+A RGAVRD+
Sbjct: 598 ATSADRGAVRDL 609


Lambda     K      H
   0.318    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1296
Number of extensions: 39
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 617
Length of database: 612
Length adjustment: 37
Effective length of query: 580
Effective length of database: 575
Effective search space:   333500
Effective search space used:   333500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

Align candidate SMc04045 SMc04045 (dihydroxy-acid dehydratase)
to HMM TIGR00110 (ilvD: dihydroxy-acid dehydratase (EC 4.2.1.9))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00110.hmm
# target sequence database:        /tmp/gapView.10375.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00110  [M=543]
Accession:   TIGR00110
Description: ilvD: dihydroxy-acid dehydratase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   3.7e-260  850.0   3.2   4.3e-260  849.8   3.2    1.0  1  lcl|FitnessBrowser__Smeli:SMc04045  SMc04045 dihydroxy-acid dehydrat


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Smeli:SMc04045  SMc04045 dihydroxy-acid dehydratase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  849.8   3.2  4.3e-260  4.3e-260       2     542 ..      18     608 ..      17     609 .. 0.99

  Alignments for each domain:
  == domain 1  score: 849.8 bits;  conditional E-value: 4.3e-260
                           TIGR00110   2 arallkatGlkdedlekPiiavvnsyteivPghvhlkdlaklvkeeieaaGgvakefntiavsDGiamgheGmky 76 
                                         ar l++atG+kd d++kPiiavvns+t++vPghvhlkdl++lv++eieaaGgvakefntiav+DGiamgh+Gm+y
  lcl|FitnessBrowser__Smeli:SMc04045  18 ARGLWRATGMKDSDFGKPIIAVVNSFTQFVPGHVHLKDLGQLVAREIEAAGGVAKEFNTIAVDDGIAMGHDGMLY 92 
                                         689************************************************************************ PP

                           TIGR00110  77 sLpsreiiaDsvetvvkahalDalvvissCDkivPGmlmaalrlniPaivvsGGpmeagktklsekidlvdvfea 151
                                         sLpsreiiaDsve++v+ah++Da+v+is+CDki+PGmlmaalrlniPa++vsGGpmeagk+ l  k + +d+++a
  lcl|FitnessBrowser__Smeli:SMc04045  93 SLPSREIIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPAVFVSGGPMEAGKVVLHGKTHALDLVDA 167
                                         *************************************************************************** PP

                           TIGR00110 152 vgeyaagklseeeleeiersacPtagsCsGlftansmacltealGlslPgsstllatsaekkelakksgkrivel 226
                                         ++++a++k+s+e+++ iersacPt+gsCsG+ftansm+cltealGlslPg++++lat+a++k+l+ ++g+ iv+l
  lcl|FitnessBrowser__Smeli:SMc04045 168 MVAAADDKVSDEDVQIIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIVDL 242
                                         *************************************************************************** PP

                           TIGR00110 227 vkknik.......PrdiltkeafenaitldlalGGstntvLhllaiakeagvklslddfdrlsrkvPllaklkPs 294
                                          +++++       Pr+i+tk+afena++ld+a+GGstntvLh+la+a e ++++++dd+drlsrkvP+l+k++P+
  lcl|FitnessBrowser__Smeli:SMc04045 243 ARRYYEqedervlPRNIATKQAFENAMALDIAMGGSTNTVLHILAAAYEGEIDFTMDDIDRLSRKVPCLSKVAPA 317
                                         *************************************************************************** PP

                           TIGR00110 295 gkkv.iedlhraGGvsavlkeldkegllhkdaltvtGktlaetlekvkvlr........................ 344
                                            v +ed+hraGG++++l+eldk gl+++d+ tv  +tl++ +++ +++r                        
  lcl|FitnessBrowser__Smeli:SMc04045 318 KADVhMEDVHRAGGIMSILGELDKGGLINRDCPTVHAETLGDAIDRWDITRtssdtvrkffraapggiptqvafs 392
                                         98888*********************************************9************************ PP

                           TIGR00110 345 ...........vdqdvirsldnpvkkegglavLkGnlaeeGavvkiagveedilkfeGpakvfeseeealeailg 408
                                                     ++ virs+++p++k+gglavLkGn+a +G++vk+agv+e+ilkf Gpa+vfes+++a+++il+
  lcl|FitnessBrowser__Smeli:SMc04045 393 qearwdeldtdRENGVIRSVEHPFSKDGGLAVLKGNIALDGCIVKTAGVDESILKFSGPARVFESQDAAVKGILA 467
                                         *******88555555************************************************************ PP

                           TIGR00110 409 gkvkeGdvvviryeGPkGgPGmremLaPtsalvglGLgkkvaLitDGrfsGgtrGlsiGhvsPeaaegGaialve 483
                                          ++k+GdvvviryeGPkGgPGm+emL+Pts+l++ GLgk++aLitDGrfsGgt+GlsiGhvsPeaa+gG+i+lv+
  lcl|FitnessBrowser__Smeli:SMc04045 468 NEIKAGDVVVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHVSPEAANGGTIGLVR 542
                                         *************************************************************************** PP

                           TIGR00110 484 dGDkikiDienrkldlevseeelaerrakakkkea.......revkgaLakyaklvssadkGavld 542
                                         +GD+i iDi+nr++ l+v+e+ela+rr ++++k++       r+v  aL++ya +++sad+Gav+d
  lcl|FitnessBrowser__Smeli:SMc04045 543 EGDMIDIDIPNRTISLRVDEAELAARRTEQDAKGWkpveqrkRRVTTALKAYAAFATSADRGAVRD 608
                                         **********************************999**9998999******************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (543 nodes)
Target sequences:                          1  (612 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
# Mc/sec: 8.90
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory