Align N-acetylornithine carbamoyltransferase (EC 2.1.3.9) (characterized)
to candidate Synpcc7942_2514 Synpcc7942_2514 ornithine carbamoyltransferase
Query= BRENDA::Q8P8J2 (339 letters) >FitnessBrowser__SynE:Synpcc7942_2514 Length = 305 Score = 136 bits (342), Expect = 8e-37 Identities = 111/337 (32%), Positives = 160/337 (47%), Gaps = 44/337 (13%) Query: 4 KHFLNTQDWSRAELDALLTQAALFKRNKLGSELKGKSIALVFFNPSMRTRTSFELGAFQL 63 + L D S AE+ +L AA K + K++ L+F S RTR SF Q+ Sbjct: 6 RDLLTLADLSSAEVLEILELAATLKSGQTTVHCP-KTLGLIFSKSSTRTRVSFSAAIMQM 64 Query: 64 GGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIGVRAFPKFVDWSKD 123 GG + L P N+ V G E IA+ ARVL RY+D + +R F + Sbjct: 65 GGQVLDLNP---------NVTQVGRG---EPIADTARVLSRYLDALAIRTFAQ------- 105 Query: 124 REDQVLKSFAKYSPVPVINMETIT-HPCQELAHALALQEHFGTPDLRGKKYVLTWTYHPK 182 Q L+ +A Y+ +PVIN T HPCQ LA +QE+FG + LT TY Sbjct: 106 ---QDLEEYAHYADIPVINALTDDYHPCQILADLQTIQENFG------QWQDLTLTYLGD 156 Query: 183 PLNTAVANSALTIATRMGMDVTLLCPTPDYILDERYMDWAAQNVAESGGSLQVSHDIDSA 242 N VA+S L ++GM+V + CP PDY ER + AQ +A +++ HD +A Sbjct: 157 GNN--VAHSLLLGCAQVGMNVRIACP-PDYQPQERIVA-KAQQIAGDRAKVEILHDPIAA 212 Query: 243 YAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNG----VFSHCLPLR 298 GA V+Y W ++ E+ + + + F + AL + HCLP Sbjct: 213 SQGAHVLYTDVWASMG------QEEEAQARVKAFTPYQLNQALLEKADPAAIVLHCLPAH 266 Query: 299 RNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALVG 335 R + T V++ D+AENRLH QKA++A L+G Sbjct: 267 REEEITAEVLEGSQSRVWDQAENRLHAQKAVLALLLG 303 Lambda K H 0.320 0.134 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 13 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 305 Length adjustment: 28 Effective length of query: 311 Effective length of database: 277 Effective search space: 86147 Effective search space used: 86147 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory