GapMind for Amino acid biosynthesis

 

Aligments for a candidate for aroC in Synechococcus elongatus PCC 7942

Align chorismate synthase (EC 4.2.3.5) (characterized)
to candidate Synpcc7942_0212 Synpcc7942_0212 chorismate synthase

Query= BRENDA::B5AAU3
         (442 letters)



>lcl|FitnessBrowser__SynE:Synpcc7942_0212 Synpcc7942_0212 chorismate
           synthase
          Length = 362

 Score =  483 bits (1242), Expect = e-141
 Identities = 237/361 (65%), Positives = 282/361 (78%), Gaps = 3/361 (0%)

Query: 55  GNIFGDYFQVATYGESHGGGVGCVISGCPPRIPLTEEDMQGDLDRRRPGQSRITTPRKET 114
           G+ FG  F+++T+GESHGGGVG VI GCPPR+ ++E ++Q +LDRRRPGQS+ITTPRKE 
Sbjct: 2   GSSFGHLFRISTFGESHGGGVGVVIDGCPPRLEISEAEIQFELDRRRPGQSKITTPRKEA 61

Query: 115 DTCKILSGTYEGMTTGTPIHVFVPNTDQRGGDYTEMAKAYRPSHADLTYDLKYGVRSVQG 174
           D C+ILSG  +G T GTPI + V N DQR  DY+EM  AYRPSHAD TYD KYG+R+V G
Sbjct: 62  DQCEILSGVVDGKTLGTPIAIVVRNKDQRSQDYSEMQVAYRPSHADATYDAKYGIRAVAG 121

Query: 175 GGRSSARETIGRVAAGAVAKKILKLKCGVEILAFVSKVHQVVLPEDAVDYETLTLDQIES 234
           GGRSSARETIGRVAAGA+AKK+L+   GVEI+ +V ++  +   E  +D ET+TL+Q+ES
Sbjct: 122 GGRSSARETIGRVAAGAIAKKLLREIAGVEIVGYVKRIKDL---EGQIDPETVTLEQVES 178

Query: 235 NICRCPDPEYAQKMIDAIDKVRINGNSIGGVVTCIARNVPRGLGSPVFDKLEALLAKAML 294
            I RCPD   A +MID I+ +   G+S+GGVV C+AR VPRGLG PVFDKLEA LAKA +
Sbjct: 179 TIVRCPDEAIAPQMIDLIEAIGREGDSLGGVVECVARRVPRGLGEPVFDKLEADLAKACM 238

Query: 295 SLPASKGFEIGSGFAGTDLTGSEHNDEFYMDEGGNVRTRTNRSGGVQGGISNGETIYFKV 354
           SLPA+KGFEIGSGFAGT++TGSEHND FY DE G +RTRTNRSGG QGGISNGE I  +V
Sbjct: 239 SLPATKGFEIGSGFAGTEMTGSEHNDAFYTDEQGQIRTRTNRSGGTQGGISNGENIVIRV 298

Query: 355 AFKPTATIGKKQNTVTRDHEDIELLTRGRHDPCVVPRAVPMVETMAALVLMDQLMAHVAQ 414
           AFKPTATI K+Q TVT   E   L  RGRHDPCV+PRAVPMVE M ALVL D L+   AQ
Sbjct: 299 AFKPTATIRKEQETVTNSGEATTLAARGRHDPCVLPRAVPMVEAMVALVLCDHLLRQQAQ 358

Query: 415 C 415
           C
Sbjct: 359 C 359


Lambda     K      H
   0.317    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 489
Number of extensions: 12
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 442
Length of database: 362
Length adjustment: 31
Effective length of query: 411
Effective length of database: 331
Effective search space:   136041
Effective search space used:   136041
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate Synpcc7942_0212 Synpcc7942_0212 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00033.hmm
# target sequence database:        /tmp/gapView.11775.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00033  [M=351]
Accession:   TIGR00033
Description: aroC: chorismate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   2.6e-145  469.7   1.4   2.9e-145  469.6   1.4    1.0  1  lcl|FitnessBrowser__SynE:Synpcc7942_0212  Synpcc7942_0212 chorismate synth


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__SynE:Synpcc7942_0212  Synpcc7942_0212 chorismate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  469.6   1.4  2.9e-145  2.9e-145       1     349 [.       9     357 ..       9     359 .. 0.98

  Alignments for each domain:
  == domain 1  score: 469.6 bits;  conditional E-value: 2.9e-145
                                 TIGR00033   1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 
                                               +r+ tfGeSHg  +g++idG+P+ le++e++iq el+rRrpgqs+ t++rkE+D+ eilsGv  GkT G
  lcl|FitnessBrowser__SynE:Synpcc7942_0212   9 FRISTFGESHGGGVGVVIDGCPPRLEISEAEIQFELDRRRPGQSKITTPRKEADQCEILSGVVDGKTLG 77 
                                               7999***************************************************************** PP

                                 TIGR00033  70 aPiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLke 138
                                               +Pia++++Nkd+rs+dy++++  +RP+Had ty  KYgi++  gggrsSaReT++rvaaGa+akklL+e
  lcl|FitnessBrowser__SynE:Synpcc7942_0212  78 TPIAIVVRNKDQRSQDYSEMQVAYRPSHADATYDAKYGIRAVAGGGRSSARETIGRVAAGAIAKKLLRE 146
                                               ********************************************************************* PP

                                 TIGR00033 139 tagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvv 207
                                                ag+eiv+yv ++ ++e +    ++++ e+++++ vrcpd+  + +m ++i+ + ++gds+Ggvve+v+
  lcl|FitnessBrowser__SynE:Synpcc7942_0212 147 IAGVEIVGYVKRIKDLEGQI-DPETVTLEQVESTIVRCPDEAIAPQMIDLIEAIGREGDSLGGVVECVA 214
                                               *****************996.5556899***************************************** PP

                                 TIGR00033 208 snvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvle.ddkirrktnnsGG 275
                                               + vp glGep+fdkl+a la+a +s++A Kg+eiG+GF+ ++++Gse+nD ++++ +++ir++tn+sGG
  lcl|FitnessBrowser__SynE:Synpcc7942_0212 215 RRVPRGLGEPVFDKLEADLAKACMSLPATKGFEIGSGFAGTEMTGSEHNDAFYTDeQGQIRTRTNRSGG 283
                                               ******************************************************9899*********** PP

                                 TIGR00033 276 ieGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladal 344
                                               ++GGi+nGe+i++r+a+Kp++ti+k+++tv+ +++ ++ a++gRhDpcv+pravp+vEamvalvl d+l
  lcl|FitnessBrowser__SynE:Synpcc7942_0212 284 TQGGISNGENIVIRVAFKPTATIRKEQETVTNSGEATTLAARGRHDPCVLPRAVPMVEAMVALVLCDHL 352
                                               *********************************99999999**************************** PP

                                 TIGR00033 345 lekra 349
                                               l+++a
  lcl|FitnessBrowser__SynE:Synpcc7942_0212 353 LRQQA 357
                                               *9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (351 nodes)
Target sequences:                          1  (362 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01
# Mc/sec: 7.12
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory