Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate Synpcc7942_2501 Synpcc7942_2501 phospho-2-dehydro-3-heoxyheptonate aldolase
Query= BRENDA::P00888 (356 letters) >FitnessBrowser__SynE:Synpcc7942_2501 Length = 354 Score = 388 bits (996), Expect = e-112 Identities = 183/344 (53%), Positives = 246/344 (71%), Gaps = 1/344 (0%) Query: 7 NNVHITDEQVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIHD 66 +++H+ + + L++P ++ PLS +A +R + I+ D RLLV+ GPCSIHD Sbjct: 5 SDLHVVETRSLISPAEIHQKLPLSETAADLVASTRDRVRSILRNSDRRLLVIVGPCSIHD 64 Query: 67 PETALEYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQI 126 A +Y ++ L E++D L +VMRVYFEKPRTTVGWKGLINDPH+DGS+D+ G+Q Sbjct: 65 VNAAYDYGQKLLPLREELADELEIVMRVYFEKPRTTVGWKGLINDPHLDGSYDINTGIQR 124 Query: 127 ARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGF 186 ARKLLL L +MGLP ATE LDP PQY+ D+ +W+AIGARTTESQTHREMASGLSMP+GF Sbjct: 125 ARKLLLGLADMGLPAATELLDPIIPQYIADVIAWTAIGARTTESQTHREMASGLSMPIGF 184 Query: 187 KNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGG-KAPNYSPA 245 KNGTDGS A NAM +A+QPH F+GIN G +++ T GNPDGH++LRGG K PNY+ A Sbjct: 185 KNGTDGSFHIAANAMLSASQPHHFLGINHDGLASIVSTTGNPDGHLVLRGGSKGPNYAAA 244 Query: 246 DVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIESN 305 D+ + ++ GL +MVDCSHGNSNKDYRRQ V + Q+ +G+R ++G+MIES+ Sbjct: 245 DIEEAAYQLASMGLHARVMVDCSHGNSNKDYRRQSVVLSDLAEQVAEGSRHLMGVMIESH 304 Query: 306 IHEGNQSSEQPRSEMKYGVSVTDACISWEMTDALLREIHQDLNG 349 + EGNQ SE++YG S+TD C+ + T+ +LRE+ + G Sbjct: 305 LVEGNQPIPADLSELRYGQSITDPCVDFPTTEKMLRELARAQRG 348 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 354 Length adjustment: 29 Effective length of query: 327 Effective length of database: 325 Effective search space: 106275 Effective search space used: 106275 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate Synpcc7942_2501 Synpcc7942_2501 (phospho-2-dehydro-3-heoxyheptonate aldolase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.24252.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-154 498.5 0.0 4.4e-154 498.3 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_2501 Synpcc7942_2501 phospho-2-dehydr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_2501 Synpcc7942_2501 phospho-2-dehydro-3-heoxyheptonate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 498.3 0.0 4.4e-154 4.4e-154 2 337 .. 6 345 .. 5 349 .. 0.98 Alignments for each domain: == domain 1 score: 498.3 bits; conditional E-value: 4.4e-154 TIGR00034 2 dlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakr 70 dl++v+ +l++P+e+++k pl+e+aa+ va++r+++ il+ +d rllv++GPcsihd +aa++y ++ lcl|FitnessBrowser__SynE:Synpcc7942_2501 6 DLHVVETRSLISPAEIHQKLPLSETAADLVASTRDRVRSILRNSDRRLLVIVGPCSIHDVNAAYDYGQK 74 78899999************************************************************* PP TIGR00034 71 lkklaeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatel 139 l +l+e+l d+leivmrvyfekPrttvGWkGlindP+l++s+d+n+G++ arklll l+++glp+atel lcl|FitnessBrowser__SynE:Synpcc7942_2501 75 LLPLREELADELEIVMRVYFEKPRTTVGWKGLINDPHLDGSYDINTGIQRARKLLLGLADMGLPAATEL 143 ********************************************************************* PP TIGR00034 140 ldtispqyladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvt 208 ld+i+pqy+ad+++w+aiGarttesq+hre+asgls+p+gfkngtdGs ++a +a+ +a+++h+fl+++ lcl|FitnessBrowser__SynE:Synpcc7942_2501 144 LDPIIPQYIADVIAWTAIGARTTESQTHREMASGLSMPIGFKNGTDGSFHIAANAMLSASQPHHFLGIN 212 ********************************************************************* PP TIGR00034 209 kaGqvaivetkGnedghiilrGGkk.pnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlev 276 ++G ++iv+t+Gn+dgh++lrGG k pny a+d++e+ +l +gl++++m+d+shgnsnkdy+rq v lcl|FitnessBrowser__SynE:Synpcc7942_2501 213 HDGLASIVSTTGNPDGHLVLRGGSKgPNYAAADIEEAAYQLASMGLHARVMVDCSHGNSNKDYRRQSVV 281 *************************9******************************************* PP TIGR00034 277 aesvveqiaeGekaiiGvmiesnleeGnqsl...keelkyGksvtdacigwedteallrklaea 337 ++++eq+aeG++ ++Gvmies+l+eGnq + +el yG+s+td c+++ +te++lr+la+a lcl|FitnessBrowser__SynE:Synpcc7942_2501 282 LSDLAEQVAEGSRHLMGVMIESHLVEGNQPIpadLSELRYGQSITDPCVDFPTTEKMLRELARA 345 ******************************965457899**********************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (354 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.45 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory