Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate Synpcc7942_1466 Synpcc7942_1466 cysteine synthase
Query= BRENDA::A8YBP8 (315 letters) >FitnessBrowser__SynE:Synpcc7942_1466 Length = 334 Score = 471 bits (1213), Expect = e-138 Identities = 235/312 (75%), Positives = 271/312 (86%) Query: 1 MLIARDITQLVGRTPLVQLNRIPVAEGVKARIVVKLESMNPAASVKDRIGVSMVEDAEAA 60 M IA++IT+L+GRTPLVQLNRIPVA+G ARIVVKLES NP+ASVKDRIG+SM+ +AE Sbjct: 15 MRIAQNITELIGRTPLVQLNRIPVADGCLARIVVKLESFNPSASVKDRIGISMILEAERK 74 Query: 61 GLIHPDKTILVEPTSGNTGIALAMVAAAKGYRLVLTMPETMSLERRAMLKAYGAQLELTP 120 GLI PD+T LVEPTSGNTGIALAM AAA+GYRL+LTMP+TMS ERRAML+AYGA LELTP Sbjct: 75 GLIAPDRTTLVEPTSGNTGIALAMAAAARGYRLILTMPDTMSSERRAMLRAYGATLELTP 134 Query: 121 GSQGMEGAITRAEEIVENTPNAYSLQQFRNPANPKIHRETTAEEIWADTDGLVDIVIGGV 180 G +GM G I RA+EIV + P AY LQQF+NPANPKIHRETTAEEIWADTDG VDI+I GV Sbjct: 135 GIEGMAGCIQRAQEIVASHPEAYMLQQFKNPANPKIHRETTAEEIWADTDGTVDILISGV 194 Query: 181 GTGGTITGIAETIKPRRPQFQAIAVEPSNSPVLSGGQPGPHKIQGIGAGFIPAIFRPELI 240 GTGGTITG+AE +K R+P FQA AVEP+NSPVLSGG+PGPHKIQGIGAGF+P + +LI Sbjct: 195 GTGGTITGVAEVLKERKPSFQAFAVEPANSPVLSGGRPGPHKIQGIGAGFVPEVLATQLI 254 Query: 241 DEVIIVDDTEAFAYARRLARQEGLLSGISAGAALWAAIQVGKRPENEDKLIVMIQPSFGE 300 DEV+ V D EA AY RRLAR+EGLLSGIS+GAA+ AA+QV +RPEN DKLIV+I PSFGE Sbjct: 255 DEVVTVSDDEAIAYGRRLAREEGLLSGISSGAAVAAAVQVARRPENTDKLIVVILPSFGE 314 Query: 301 RYLSTALFKDLE 312 RYLST LF++ E Sbjct: 315 RYLSTPLFQEPE 326 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 334 Length adjustment: 28 Effective length of query: 287 Effective length of database: 306 Effective search space: 87822 Effective search space used: 87822 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate Synpcc7942_1466 Synpcc7942_1466 (cysteine synthase)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.23805.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-148 478.5 0.1 4.6e-148 478.3 0.1 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_1466 Synpcc7942_1466 cysteine synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_1466 Synpcc7942_1466 cysteine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 478.3 0.1 4.6e-148 4.6e-148 1 298 [] 21 322 .. 21 322 .. 0.99 Alignments for each domain: == domain 1 score: 478.3 bits; conditional E-value: 4.6e-148 TIGR01139 1 iseliGntPlvrLn...laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgk.tiveats 65 i+eliG+tPlv+Ln +a+++ a+++vkles+nPs+svkdri+++mi +ae++gl+ +++ t+ve+ts lcl|FitnessBrowser__SynE:Synpcc7942_1466 21 ITELIGRTPLVQLNripVADGCLARIVVKLESFNPSASVKDRIGISMILEAERKGLIAPDRtTLVEPTS 89 689***********9888999**************************************9879****** PP TIGR01139 66 GntGialamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkyl 134 GntGialam aaargy+liltmp+tms err++l+ayGa l Lt+g egm+g+i++a+e+v+++p++y lcl|FitnessBrowser__SynE:Synpcc7942_1466 90 GNTGIALAMAAAARGYRLILTMPDTMSSERRAMLRAYGATLELTPGIEGMAGCIQRAQEIVASHPEAY- 157 ********************************************************************. PP TIGR01139 135 llkqfenpanpeihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespv 203 +l+qf+npanp+ihr+tta+ei+ d+dg++d++++gvGtGGtitGv+evlke kp+++++avePa+spv lcl|FitnessBrowser__SynE:Synpcc7942_1466 158 MLQQFKNPANPKIHRETTAEEIWADTDGTVDILISGVGTGGTITGVAEVLKERKPSFQAFAVEPANSPV 226 ********************************************************************* PP TIGR01139 204 lsggkpgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkva 272 lsgg+pgphkiqGigagf+P+vL +++idev++vsd+eai+++rrla+eeG+l+GissGaavaaa++va lcl|FitnessBrowser__SynE:Synpcc7942_1466 227 LSGGRPGPHKIQGIGAGFVPEVLATQLIDEVVTVSDDEAIAYGRRLAREEGLLSGISSGAAVAAAVQVA 295 ********************************************************************* PP TIGR01139 273 kkle.kdkkivvilpdtgerYlstaLf 298 +++e +dk+ivvilp++gerYlst+Lf lcl|FitnessBrowser__SynE:Synpcc7942_1466 296 RRPEnTDKLIVVILPSFGERYLSTPLF 322 ***99*********************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (334 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.08 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory