Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate Synpcc7942_2087 Synpcc7942_2087 imidazole glycerol phosphate synthase subunit HisF
Query= curated2:A2SQR0 (236 letters) >FitnessBrowser__SynE:Synpcc7942_2087 Length = 255 Score = 121 bits (304), Expect = 1e-32 Identities = 74/238 (31%), Positives = 126/238 (52%), Gaps = 12/238 (5%) Query: 3 VFPAVDILSGNCVQLVGGDRLTATVYGSPMDNARRWISEGASNLHVVNLDGAFTASTTNA 62 + P +D+ +G V+ G + + G P++ A+ + + GA L +++ Sbjct: 6 ILPCLDVKAGRVVK--GVNFVDLRDAGDPVELAQAYDAAGADELVFLDIAATHEERQILV 63 Query: 63 EMIREVVEKTDVFVQVGGGIRSLEDARGWLNCGVARIILSTFATREPAVIRTLSKEFGSE 122 +++ E+ + + VGGGI LE R L G ++ +++ A R+P +IR S FGS+ Sbjct: 64 DVVYRTAEQVFIPLTVGGGINDLETIRQLLRAGADKVSINSAAVRDPDLIRRASDRFGSQ 123 Query: 123 RIMAGVDARRG--------EIAVSGWQELAG-DFIVWAQKFEELGAGSLLYTNVDVEGQQ 173 I+ +DARR ++ V G +E G D + WA+ GAG LL T++D +G Q Sbjct: 124 CIVVAIDARRRTDPDNPGWDVYVRGGRENTGIDALTWAETVARNGAGELLVTSMDADGTQ 183 Query: 174 AGIDIEPVQKLLDAVDIPVIVAGGVTTSQDVTALKQLG-ASGCVLGSALYSGRITLKE 230 AG D+E + + D V+IPVI +GG T +D+ + G A +L S L+ G++T+ E Sbjct: 184 AGYDLELTRAIADRVEIPVIASGGAGTCEDIAEAFRTGHAEAALLASLLHYGQLTIAE 241 Lambda K H 0.318 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 255 Length adjustment: 24 Effective length of query: 212 Effective length of database: 231 Effective search space: 48972 Effective search space used: 48972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory